SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000040212 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000040212
Domain Number 1 Region: 338-431
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.1e-22
Family UBX domain 0.00011
Further Details:      
 
Domain Number 2 Region: 139-291
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000962
Family UAS domain 0.086
Further Details:      
 
Domain Number 3 Region: 10-63
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000385
Family Ubiquitin-related 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000040212   Gene: ENSMMUG00000019056   Transcript: ENSMMUT00000047186
Sequence length 464
Comment pep:known chromosome:MMUL_1:1:53269494:53530092:-1 gene:ENSMMUG00000019056 transcript:ENSMMUT00000047186 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLIITHREVQREYNLNFSGSSTIQEVKRNVYDLTSIPVRHQLWEGWPTSATDDSMCLAES
GLSYPCHRLTVGRRSSPAQTREQSEEQSTDVHMVSDSDGDDFEDATEFGVDDGEVFGMAS
SALRKSPMMPENAENEGDALLQFTAEFSSRYGDCHPVFFIGSLEAAFQEAFYVKARDRKL
LAIYLHHDESVLTNVFCSQMLCAESIVSYLSQNFITWAWDLTKDSNRARFLTMCNRHFGS
VVAQTIRTQKTDQFPLFLIIMGKRSSNEVLNVIQGNTTVDELMMRLMAAMEIFTAQQQED
IKDEDEREARENVKREQDEAYRLSLEADRAKREAHEREMAEQFRLEQIRKEQEEEREAIR
LSLEQALPPEPKEENAEPVSKLRIRTPSGEFLERRFLASSKLQIVFDFVASKGFPWDEYK
LLSTFPRRDIPGLSRMGKHACSHSFYIHFMFFILILKTWIISCF
Download sequence
Identical sequences ENSMMUP00000040212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]