SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000040294 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000040294
Domain Number 1 Region: 68-126
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000556
Family Homeodomain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000040294   Gene: ENSMMUG00000032159   Transcript: ENSMMUT00000047267
Sequence length 148
Comment pep:known_by_projection chromosome:MMUL_1:11:8064873:8065737:1 gene:ENSMMUG00000032159 transcript:ENSMMUT00000047267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DQNPEQSTENYSEDEQNGKQKWREGGREAGRKREREKEEENEKELEDEPENKRKRENKKH
KQYPEKRLVSKSLMDTLWAKFKLSRCPTIQESLSLSFEFDMTHKQISQWFCKKRKKYNKE
MSKRKHKKNIRDKVSPCWPGWSRIPDLR
Download sequence
Identical sequences ENSMMUP00000040294 9544.ENSMMUP00000040294 ENSMMUP00000040294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]