SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000040576 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000040576
Domain Number 1 Region: 213-274
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000113
Family LIM domain 0.0073
Further Details:      
 
Domain Number 2 Region: 270-299
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000965
Family LIM domain 0.018
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000040576
Domain Number - Region: 182-211
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0011
Family LIM domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000040576   Gene: ENSMMUG00000032243   Transcript: ENSMMUT00000047545
Sequence length 373
Comment pep:novel chromosome:MMUL_1:1:18552557:18564664:1 gene:ENSMMUG00000032243 transcript:ENSMMUT00000047545 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASKPEKRVASSVFITLAPPRRDVAVAEEVRQAVCEARRGRPWAPPAPVKTPEAGLARRP
SPWTPPGKAATTVPAAPLQLSNGGCPPPPPVLDGEDVLPDLDLLPPPPPPPPVLLPSEEE
APAPMGTSLIADLQQLHLSPPPPPPPPQAPAEGPSVQPGPLRPVEEELPPPPAEPVEKEA
STDICAFCHKTVSPRELAVEAMKRQYHAQCFTCRTCRRQLAGQSFYQKDGRPLCEPCYQD
TLEKCGKCGEVVQDHIIRALGQAFHPSCFTCVTCARCIGDESFALGSQNEVYCLDDFYRY
ERGLTRWGAGTGRDPSRMKEPSLSPGCWARVSCLLVYYKEYYRPGAVAQACNPSTLGGRD
GWITRSGDQDHPG
Download sequence
Identical sequences ENSMMUP00000040576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]