SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000040577 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000040577
Domain Number 1 Region: 114-175
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.91e-16
Family LIM domain 0.0073
Further Details:      
 
Domain Number 2 Region: 172-241
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000761
Family LIM domain 0.026
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000040577
Domain Number - Region: 84-112
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000234
Family LIM domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000040577   Gene: ENSMMUG00000032243   Transcript: ENSMMUT00000047546
Sequence length 276
Comment pep:known chromosome:MMUL_1:1:18552557:18573153:1 gene:ENSMMUG00000032243 transcript:ENSMMUT00000047546 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASKPEKRVASSVFITLAPPRRDVAVAEEVRQAVCEARRGRPWAPPAPVKTPEAGLARRP
SPWTPPGKAATTVPAAPLQLSNGDICAFCHKTVSPRELAVEAMKRQYHAQCFTCRTCRRQ
LAGQSFYQKDGRPLCEPCYQDTLEKCGKCGEVVQDHIIRALGQAFHPSCFTCVTCARCIG
DESFALGSQNEVYCLDDFYRKFAPVCSICENPIIPRDGKDAFKIECMGRNFHENCYRCED
CRILLSVEPTDQGCYPLNNRLFCKPCHVKRSAAGCC
Download sequence
Identical sequences A0A2K5VP85 F7FNQ2
ENSMMUP00000040577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]