SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000040696 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000040696
Domain Number 1 Region: 96-178
Classification Level Classification E-value
Superfamily SH2 domain 0.000000000000105
Family SH2 domain 0.00055
Further Details:      
 
Domain Number 2 Region: 2-54
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000101
Family SH2 domain 0.00097
Further Details:      
 
Domain Number 3 Region: 261-377
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 0.0000000589
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000040696   Gene: ENSMMUG00000018694   Transcript: ENSMMUT00000047673
Sequence length 391
Comment pep:novel chromosome:MMUL_1:1:4141006:4145296:1 gene:ENSMMUG00000018694 transcript:ENSMMUT00000047673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HSGWLHPEVRGVEAEQLFLSRGQCGNFLARPSESSPGGFMVSVRGRRAGKVVRVGRSAGR
PLGGKELFREAFGEASLSQGLRRTLSCPSLGVQLRCLLGCQDPTSECTYHGSLSGKEAEK
LLLQKGRPGSFLVHESQSSPGDLPLSVLTQEWDKAQGVGCQPRVTHILICFQVGGGGGLG
RPLGRAGSLGQAPQRRPHSQMRSRMWETGSTWIPSETQWSPTMEKAGAVVHLKQPLKATR
ISARSLERCVQELSRATDASGKARQGFWVEFEMLQQQECWFLYPGKEGQRVENKPKNHCE
GRGQGVTRRAWGSDKDDSGPGADYIRVGVRRSAPGGPRKNQGPQVYIATQGCLQAVVHQE
NTRGIVTTSREVERGRVGARCRHSQCPSHPV
Download sequence
Identical sequences ENSMMUP00000040696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]