SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000040699 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000040699
Domain Number 1 Region: 1338-1545
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.33e-44
Family Laminin G-like module 0.00024
Further Details:      
 
Domain Number 2 Region: 1867-2023
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-36
Family Laminin G-like module 0.000000696
Further Details:      
 
Domain Number 3 Region: 35-124
Classification Level Classification E-value
Superfamily TIMP-like 2.12e-34
Family The laminin-binding domain of agrin 0.000013
Further Details:      
 
Domain Number 4 Region: 469-536
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 8.32e-16
Family Ovomucoid domain III-like 0.0099
Further Details:      
 
Domain Number 5 Region: 1597-1782
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000369
Family Laminin G-like module 0.0042
Further Details:      
 
Domain Number 6 Region: 547-599
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000735
Family Ovomucoid domain III-like 0.0057
Further Details:      
 
Domain Number 7 Region: 195-243
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000166
Family Ovomucoid domain III-like 0.0048
Further Details:      
 
Domain Number 8 Region: 1134-1212
Classification Level Classification E-value
Superfamily SEA domain 0.000000000000785
Family SEA domain 0.0039
Further Details:      
 
Domain Number 9 Region: 618-665
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000236
Family Ovomucoid domain III-like 0.011
Further Details:      
 
Domain Number 10 Region: 699-750
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000305
Family Ovomucoid domain III-like 0.0031
Further Details:      
 
Domain Number 11 Region: 400-462
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000638
Family Ovomucoid domain III-like 0.005
Further Details:      
 
Domain Number 12 Region: 793-836
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000014
Family Laminin-type module 0.0048
Further Details:      
 
Domain Number 13 Region: 342-390
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000277
Family Ovomucoid domain III-like 0.0098
Further Details:      
 
Domain Number 14 Region: 249-319
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000568
Family Ovomucoid domain III-like 0.006
Further Details:      
 
Domain Number 15 Region: 847-884
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000279
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 16 Region: 1538-1573
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000559
Family EGF-type module 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000040699   Gene: ENSMMUG00000000838   Transcript: ENSMMUT00000047676
Sequence length 2026
Comment pep:known_by_projection chromosome:MMUL_1:1:4095194:4131051:1 gene:ENSMMUG00000000838 transcript:ENSMMUT00000047676 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGPSRPGPLRPLLLLVVAACVLPGAGGTCPERALERREEEANVVLTGTVEEILNVDPVQ
HTYSCKVRVWRYLKGKELVARESLLDGGNKVVISGFGDPLICDNQVQVGDVSVYAGWPGI
PIVWPCVWTRGLMPASFPNMSLRGLGPNLGVCFLPDKPGIHFTPVPPTPPDACRGMLCGF
GAVCEPNAEGPGRASCVCKKGPCPSVVAPVCGSDASTYSNECELQRAQCSQQRRIRLLSR
GPCGSRDPCSNVTCSFGSTCARSADGLTASCLCPATCRGAPEGTVCGSDGADYPGECQLL
RRACARQENVFKKFDGPCDPCQGALPDPSRSCRVNPRTRRPEMLLRPESCPARRAPVCGD
DGVTYENDCVMGRSGAARGLLLQKVRSGQCQSRDQCPEPCRFNAVCLTRRGRPRCSCDRV
TCDGAYRPVCAQDGHTYDSDCWRQQAECQQQRAIPSKHQGPCGQAPSPCLGVQCAFGATC
AVKNGQAACECRQACSSLYDPVCGGDGVTYGSTCELEATACTLGREIRVARKGPCDPCGQ
FRGALCEAETGRCVCPSECVALAQPVCGSDGHTYPSECMLHVHACTHQISLHVASTGPCE
TCGDAVCAFGAVCSAGQCVCPRCEHPPPGPVCGSDGVTYGSACELREAACRQQTQIEEAR
AGPCEQAECGSGGSGSGEDGDCEQELCRQRGGIWDEDSEDGPCVCDFSCQSVLGGPVCGS
DGVTYSTECELKKARCESRQELSVAAQGACRGPTFAPLLPVAPSHCAQMPYGCCQDNITA
ARGVDLAGCPSACQCNPHGSYGGTCDPVTGQCSCRPGVGGLRCDRCEPGFWNFRGIVTDG
RSGCTPCSCDPQGAVRDDCEQMTGLCSCKPGVAGPKCGQCPDGRALGPAGCEADASAPTT
CAEMRCEFGALCVEESGSAHCVCPVLTCPEANVTKVWGVECEGETWGGRAGTERFRPRAW
AQSMSPQGSSPSRAAAWQPLGHPSRGLPATTPLWAAALMGRRPRWTQRAPTALPGLGRGA
APSPGQQVSARVMVLGLGPLKHVRARDPTPNPSLSLQAGVAHCSEESLVTDTSPTLGSPL
TDHLTNIHLPLAAGACARASLDPGRCQAGPHCTSPTATKVFQGVLELEGVEGQELFYTPE
MADPKSELFGETARSIESTLDDLFWNSDVKKDFRSVRLRDLGPGKSVRAIVDVHFDPTTA
FRAPDVARALLRQIQVSRRRSLGVRRPLQEHVRFMDFDWFPAFFTGVTSGAIAAVATARA
TTASRLPSSAVTPRTLHPSHTSQPVAKTTAAPTTRRPPTTAPSRVPGRRPLAPQQPPKPC
DSQPCFHGGTCQHQVSGGGFTCSCPAGRGGSTCEKALGAPVPAFEGRSFLAFPTLRAYHT
LRLALEFRALELQGLLLYNGNARGKDFLALALLDGRVQLRFDTGSGPAVLTSAVPVEPGR
WHRLELSRHWRRGTLSVDGETPVLGESPSGTDGLNLDTDLFVGGVPEDQAAVALERTSVG
AGLRGCIRLLDVNNQLLELGIGPGAATRGSGVGECGSHPCLPNPCRGGAPCQALEAGRFH
CQCPPGRVGPTCADEKSPCQPNPCHGAAPCRVLPEGGAQCECPLGRGGTLCQTASGQDGS
GPFVADFNGFSHLELRGLHTFARDLGSVGQERGRAGLHLCLSPPTGRSGPGGSGGRWRPE
PTHTDPSTRSKEPVTLGAWTRVSLERNGRKGAMRVGDGPRVLGESPVPHTVLNLKEPLYV
GGAPDFSELARAAAVSSGFNGAIQLVSLGGRQLLTPEHVLRQVDPLVSISCHPTPTSLIS
VPSLGRAPAAYDPRGHVCLLPGPFTGEHPPLALVASAAGALVLPPPPPCPVATFLEALTC
PLPSSEKALQSNHFELSLRTEATQGLVLWSGKATERADYVALAIVDGHLQLSYNLGSQPV
VLRSTVPVNTNRWLRVVAHREQREGSLQVGNEAPVTGSSPLGATQLDTDGALWLGGLPEL
PVGPALPKAYGTGFVGCLRDVVVGQRPLHLLEDAIAKPELRPCPAP
Download sequence
Identical sequences ENSMMUP00000040699 ENSMMUP00000040698 9544.ENSMMUP00000040699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]