SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000040759 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000040759
Domain Number 1 Region: 60-342
Classification Level Classification E-value
Superfamily L domain-like 8.84e-58
Family Ngr ectodomain-like 0.000000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000040759   Gene: ENSMMUG00000012743   Transcript: ENSMMUT00000012999
Sequence length 366
Comment pep:known chromosome:MMUL_1:X:151599393:151613954:1 gene:ENSMMUG00000012743 transcript:ENSMMUT00000012999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLWLLASLLALSQALPFEQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAM
CPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLV
NNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGL
RNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQ
AIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLARVPSGLPDLKLL
QVVYLHSNNITKVGVNDFCPVGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQ
FGNYKK
Download sequence
Identical sequences 9544.ENSMMUP00000040759 ENSMMUP00000016739 ENSMMUP00000016739 ENSMMUP00000040759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]