SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000040768 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000040768
Domain Number 1 Region: 20-77
Classification Level Classification E-value
Superfamily GLA-domain 1.06e-21
Family GLA-domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000040768   Gene: ENSMMUG00000016929   Transcript: ENSMMUT00000047740
Sequence length 197
Comment pep:known chromosome:MMUL_1:X:149777785:149778814:1 gene:ENSMMUG00000016929 transcript:ENSMMUT00000047740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSSVFLEAKDAHSVLKRFPRANEFLEELRQGTIERECMEEICSYEEVKEVFENKEKTMEF
WKGYPNAVYSVRDPSQSSDAMYVVVPLLGVALLIVIALFIIWRCQLQKATRHQGEPSGHR
EAVSSPQVVVGPSQGGRTTVRLESTLYLPELSLSRLSSTTPPPSYEEVTAPQESSSEEAS
MSYSDPPPKYEEIVAAN
Download sequence
Identical sequences ENSMMUP00000040768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]