SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000040872 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000040872
Domain Number 1 Region: 114-181
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000303
Family VWC domain 0.039
Further Details:      
 
Domain Number 2 Region: 258-325
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000471
Family VWC domain 0.0087
Further Details:      
 
Domain Number 3 Region: 35-102
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000018
Family VWC domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000040872   Gene: ENSMMUG00000016666   Transcript: ENSMMUT00000047843
Sequence length 458
Comment pep:known chromosome:MMUL_1:X:109341808:109457558:-1 gene:ENSMMUG00000016666 transcript:ENSMMUT00000047843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKKWKMGGMKYIFSLLFFLFLEGGKTEQVKHSETYCMFQDKKYRVGERWHPYLEPYGLV
YCVNCICSENGNVLCSRVRCPNVHCLSPVHIPHLCCPRCPEDSLPPVNNKVTSKSCEYNG
TTYQHGELFVAEGLFQNRQPNQCTQCSCSEGNVYCGLKTCPKLTCAFPVSVPDSCCRVCR
GDGELSWEHSDGDIFRQPANREARHSYHRSHYDPPPSRQAGGLSRFPGARSHRGALMDSQ
QASGTIVQIVINNKHKHGQVCVSNGKTYSHGESWHPNLRAFGIVECVLCTCNVTKQECKK
IHCPNRYPCKYPQKIDGKCCKVCPGKKAKEELPGQSFDNKGYFCGEETMPVYESVFMEDG
ETTRKIALETERPPQVEVHVWTIRKGILQHFHIEKISKRMFEELPHFKLVTRTTLSQWKI
FTEGEAQISQMCSSRVCRTELEDLVKVLYLERSEKGHC
Download sequence
Identical sequences A0A096NFG4 A0A2K5NX49 A0A2K5X1J2 A0A2K5Y4G6 A0A2K6D8Z0 F6W0P3
ENSMMUP00000040872 NP_001244802.1.72884 XP_005594422.1.63531 XP_005594423.1.63531 XP_005594424.1.63531 XP_011754435.1.29376 XP_011754436.1.29376 XP_011839896.1.47321 XP_011839897.1.47321 XP_011943113.1.92194 XP_011943114.1.92194 XP_014983474.1.72884 ENSMMUP00000021916 9544.ENSMMUP00000040872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]