SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000040919 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000040919
Domain Number 1 Region: 63-224
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.31e-26
Family Protein kinases, catalytic subunit 0.0000000937
Further Details:      
 
Domain Number 2 Region: 1-74
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000000000754
Family SH2 domain 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000040919   Gene: ENSMMUG00000019573   Transcript: ENSMMUT00000047886
Sequence length 234
Comment pep:known chromosome:MMUL_1:X:100066587:100075475:-1 gene:ENSMMUG00000019573 transcript:ENSMMUT00000047886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RHYVVCSTPQSQYYLAEKHLFSTIPELINYHQHNSAGLISRLKYPVSQQNKNAPSTAGLG
YGSWEIDPKDLTFLKELGTGQFGVVKYGKWRGQYDVAIKMIKEGSMSEDEFIEEAKVMMY
VLDDEYTSSVGSKFPVRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYERFTNSE
TAEHIAQGLRLYRPHLASEKVYTIMYSCWHEKADERPTFKILLSNILDVMDEES
Download sequence
Identical sequences Q572P5
ENSMMUP00000040919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]