SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000040937 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000040937
Domain Number 1 Region: 558-679
Classification Level Classification E-value
Superfamily Cadherin-like 1.44e-30
Family Cadherin 0.0018
Further Details:      
 
Domain Number 2 Region: 454-562
Classification Level Classification E-value
Superfamily Cadherin-like 1.44e-29
Family Cadherin 0.001
Further Details:      
 
Domain Number 3 Region: 237-360
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-28
Family Cadherin 0.00098
Further Details:      
 
Domain Number 4 Region: 133-241
Classification Level Classification E-value
Superfamily Cadherin-like 4.71e-22
Family Cadherin 0.0023
Further Details:      
 
Domain Number 5 Region: 666-772
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-20
Family Cadherin 0.0024
Further Details:      
 
Domain Number 6 Region: 348-458
Classification Level Classification E-value
Superfamily Cadherin-like 8.99e-16
Family Cadherin 0.0043
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000040937
Domain Number - Region: 27-98
Classification Level Classification E-value
Superfamily Cadherin-like 0.0585
Family Cadherin 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000040937   Gene: ENSMMUG00000012777   Transcript: ENSMMUT00000047904
Sequence length 1025
Comment pep:novel chromosome:MMUL_1:X:90534425:90626784:1 gene:ENSMMUG00000012777 transcript:ENSMMUT00000047904 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLLSGTYIFAVLLACVVFHSGAQEKNYTIREEMPENVLIGDLLKDLNLSLVSNKSLSSA
MQFKLVYKTGDVPLIRIEEGTGEIFTTGARIDREKLCVGIPTDEQCFYEVEVAILPDEIF
RLVKIRFLIEDINDNAPLFPTTVINISIPENSAINSKYTLPAAIDPDVGINGVQNYELIK
GQNIFGLDVIETPEGEKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVT
DTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENARIHFSFSNLVSNIAKRLF
HLNSTTGLITIKEPLDREETPNHKLLVLASDGGLVPARAMVLVNVTDVNDNVPSIDIRYI
VNPINDTVVLSENVPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLLET
AAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSLVTVSIPENNS
PGIQLTKVSATDADTGPNAEINFLLGPDAPPEFSLDRRTGMLTVLKKLDREKEEKYFFTV
LAKDNGVPPLTSNVTVFVSVIDQNDNSPAFTHNEYNFYVPENLPKHGTVGLITVTDPDYG
ENSAVTLSILDENDGFTIDSKTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVT
INVVDVNDNKPVFIVPPSNYSYELVLPSTDPGTVVFQVIAVDNDTGMNAEVRYSIVGENT
RDLFEINETTGNIIMKEKCDVTDLGLHRVLVKANDLGQPDSLFSVVTVNLFVNESVTNAT
LINELLHKSTEAPVTPNTEIADASSPTIDYVKILVAVVAGTITVVVVISITAVVRCRQAP
HLKAAQKNKQNSEWATPNPENRQMIMMKKKKKKKKHPPKNLLLNFVTIEETKADDVDDDG
NSITLELPIDLEEQTMGKYNWVTTPTTFKPDSPDLARHYKSASPQPAFQIQPETPLNSKH
HIIQELPLDNTFVACDSISKCSSSSSDPYSVSDSGYPVTTFEAPVSVHARPTDSRTSPIE
ICSEI
Download sequence
Identical sequences F6USJ6
ENSMMUP00000040937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]