SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000041003 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000041003
Domain Number 1 Region: 2-495
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 2.23e-127
Family Gamma-glutamyltranspeptidase-like 0.00000355
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000041003   Gene: ENSMMUG00000020999   Transcript: ENSMMUT00000047965
Sequence length 496
Comment pep:known_by_projection scaffold:MMUL_1:1099548049568:643433:680790:-1 gene:ENSMMUG00000020999 transcript:ENSMMUT00000047965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YARAAVAADAKHCSEIGRDALQDGGSAVDAAIAALLCVGLMNAHSMGIGGGLFFTIYNST
TRKAEVINAREVAPRLAFASMFNSSEQSQDGGLSVAVPGEIRGFELAHQRHGRLPWARLF
QPSIQLARQGFPVGKSLAAALKNKRTAPPLFCSIPLEVFCRDGKVLREGERLTLPRLADT
YETLAIEGAQAFYNGSLTAQIVKDIQAAGEWITSGDLNNYRAELIEHPLNISLGDAVLYM
PSVPLSGPVLALILNILKGFNFSAESVARPEGRVNMYHHLVETLKFARGQRWRLGDPRSH
PKLQNASRDLLEETLAQLIRQQIDGRGDHQLSHYSLAEAWGHGTGTSHVSVLGEDGSAVA
ATSTINTPFGAMVYSPRTGIILNNELLDLCERCPRGSGTTPSPVNGDRVSGAPGGCWPPV
PGERSPSSMVPSILISKAQGSKLVIGGAGGELIISAVAQAIMNKLWLGFDLRAAIAAPIL
HVNSKGCVEYEPSFSQ
Download sequence
Identical sequences ENSMMUP00000041003 9544.ENSMMUP00000041003 ENSMMUP00000003059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]