SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000041011 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000041011
Domain Number 1 Region: 37-143
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.65e-19
Family Glutathione S-transferase (GST), C-terminal domain 0.00021
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000041011
Domain Number - Region: 3-37
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000314
Family Glutathione S-transferase (GST), N-terminal domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000041011   Gene: ENSMMUG00000020989   Transcript: ENSMMUT00000047973
Sequence length 160
Comment pep:novel scaffold:MMUL_1:1099548049568:397008:406067:-1 gene:ENSMMUG00000020989 transcript:ENSMMUT00000047973 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLELYLDLLSQPCRAVYIFAKKNGIPFELRIVDLIKVMFPVFLGEPVSPQTLAATLAEL
DVNLQLLEDKFLQNKAFLTGPHISLADLVAITELMHPVGAGCQVFESRPKLATWRQRVEA
AVGEDLFREAHEVILKAKDFPPADPTIKQKLMPWVLAMIR
Download sequence
Identical sequences ENSMMUP00000041011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]