SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000041101 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000041101
Domain Number 1 Region: 202-307
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000000000584
Family Canonical RBD 0.0054
Further Details:      
 
Domain Number 2 Region: 62-134
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000462
Family Canonical RBD 0.0069
Further Details:      
 
Domain Number 3 Region: 131-159
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000107
Family Ran binding protein zinc finger-like 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000041101
Domain Number - Region: 664-720
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00202
Family Classic zinc finger, C2H2 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000041101   Gene: ENSMMUG00000017423   Transcript: ENSMMUT00000048062
Sequence length 846
Comment pep:known chromosome:MMUL_1:X:44999697:45016947:1 gene:ENSMMUG00000017423 transcript:ENSMMUT00000048062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGRGDRTGRYGATDRSQDDGGENRSRDHDYRDMDYRSYPREYGSQEGKHDYDDSSEEQSA
EIRGQLQSHGVQAREVRLMRNKSSGQSRGFAFVEFSHLQDATRWMEANQHSLNILGQKVS
MHYSDPKPKINEDWLCNKCGVQNFKRREKCFKCGVPKSEAEQKLPLGTRLDQQTLPLGGR
ELSQGLLPLPQPYQAQGVLASQALSQGSEPSSENANDTIILRNLNPHSTMDSILGALAPY
AVLSSSNVRVIKDKQTQLNRGFAFIQLSTIEAAQLLQILQALHPPLTIDGKTINVEFAKG
SKRDMASNEGSRISAASVASTAIAAAQWAISQASQGGEGAWATSEEPPVDYSYYQQDEGY
GNSQGTESSLYAHGYLKGTKGPGITGTKGDPTGAGPEASLEPGADSVSMQAFSRAQPGAA
PGIYQQSAEASSSQGTAANSQSYTIMSPAVLKSELQSPTHPSSALPPATSPTAQESYSQY
PVPDVSTYQYDETSGYYYDPQTGLYYDPNSQYYYNAQSQQYLYWDGERRTYVPALEQSAD
GHKETGAPSKEGKEKKEKHKTKTAQQIAKDMERWARSLNKQKENFKNSFQPISSLRDDER
RESATADAGYAILEKKGALAERQHTSMDLPKLASDDRPSPPRGLVAAYSGESDSEEEQER
GGPEREEKLTDWQKLACLLCRRQFPSKEALIRHQQLSGLHKQNLEIHRRAHLSENELEAL
EKNDMEQMKYRDRAAERREKYGIPEPPEPKRRKYGGISTASVDFEQPTRDGLGSDNIGSR
MLQAMGWKEGSGLGRKKQGIVTPIEAQTRVRGSGLGARGSSYGVTSTESYKETLHKTMVT
RFNEAQ
Download sequence
Identical sequences ENSMMUP00000041101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]