SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000041158 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000041158
Domain Number 1 Region: 6-47
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 7.06e-16
Family Skp1 dimerisation domain-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000041158   Gene: ENSMMUG00000016298   Transcript: ENSMMUT00000022890
Sequence length 47
Comment pep:novel chromosome:MMUL_1:18:62856336:62856476:1 gene:ENSMMUG00000016298 transcript:ENSMMUT00000022890 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTV
Download sequence
Identical sequences ENSMMUP00000041158 ENSETEP00000002125 9544.ENSMMUP00000041158 ENSETEP00000002125 ENSTBEP00000003872 ENSMMUP00000041158 ENSTBEP00000003872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]