SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000041189 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000041189
Domain Number 1 Region: 7-113
Classification Level Classification E-value
Superfamily SRP19 1.7e-26
Family SRP19 0.00000357
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000041189   Gene: ENSMMUG00000032515   Transcript: ENSMMUT00000048150
Sequence length 131
Comment pep:novel chromosome:MMUL_1:18:52451636:52452111:1 gene:ENSMMUG00000032515 transcript:ENSMMUT00000048150 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TAAWFPANQDRFICIYAAYLSNKTIAEGRRIPVSEAVENPTATEIQDVCSEVGLNVFLEK
NKMYSRERNHDVQHGDRVRVQLRQEDGGLCLVQFLSCKSVMLYAAEITPKLKRRTQKTGG
GDQSLQNTNGS
Download sequence
Identical sequences 9544.ENSMMUP00000041189 ENSMMUP00000041189 ENSMMUP00000041189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]