SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000041265 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000041265
Domain Number 1 Region: 40-199
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000422
Family SMI1/KNR4-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000041265   Gene: ENSMMUG00000006863   Transcript: ENSMMUT00000048226
Sequence length 304
Comment pep:known chromosome:MMUL_1:18:29714469:29756930:-1 gene:ENSMMUG00000006863 transcript:ENSMMUT00000048226 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEEASPPGLGCSKPHLEKLTLGITRILESSPGVTEVTIIEKPPAERHMISSWEQKNNCV
MPEDVKNFYLMTNGFHMTWSVKLDEHIIPLGSMAINSISKLTQLTQSSMYSLPNAPTLAD
LEDDTHEASDDQPEKPHFDSRSVIFELDSCNGSGKVCLVYKSGKPALAEDTEIWFLDRAL
YWHFLTDTFTAYYRLLITHLGLPQWQYAFTSYGISPQAKITYNIKMNRRKCVHWKLAVES
LQWELRSCVSAGMGTGHKQRGSGTKPWSCSVCSRHQSNGMGTAVLQSFLSYGKNVLFFTV
RCCF
Download sequence
Identical sequences A0A2I3MS73 A0A2K5LFH6 G7NKM1 G7PWN9
ENSMMUP00000009018 9544.ENSMMUP00000041265 XP_005586903.1.63531 XP_011930103.1.92194 XP_014977221.1.72884 ENSMMUP00000041265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]