SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000041300 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000041300
Domain Number 1 Region: 299-358
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000156
Family Laminin-type module 0.054
Further Details:      
 
Domain Number 2 Region: 356-428
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000018
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 3 Region: 491-535
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000145
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 4 Region: 426-468
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000134
Family Laminin-type module 0.023
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000041300
Domain Number - Region: 104-185
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000145
Family APC10-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000041300   Gene: ENSMMUG00000004321   Transcript: ENSMMUT00000048264
Sequence length 543
Comment pep:known chromosome:MMUL_1:18:16708945:16808363:1 gene:ENSMMUG00000004321 transcript:ENSMMUT00000048264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAARPRGRAPGPVLPPTPLLLLVLQLLPAWGATARDPRAAAGLSLHPPYFNLAEAARI
WATATCGERGPSERRPRPELYCKLVGGPTAPGSGHTIQGQFCDYCNSEDPRKAHPVTNAI
DGSEHWWQSPPLSSGTQYNRVNLTLDLGQLFHVAYILIKFANSPRPDLWVLERSVDFGST
YSPWQYFAHSKVDCLKEFGREANMAVTRDDDVLCVTEYSRIVPLENGEVVVSLINGRPGA
KNFTFSHTLREFTKATNIRLRFLRTNTLLGHLISKAQRDPTVTRRYYYSIKDISIGGRCV
CNGHAEVCNANNPEKLFRCQCQHHTCGETCDRCCTGYNQRRWQPAAWEQSHECEACNCHG
HASDCYYDSDVERQQASLNTQGIYAGGGVCINCQHNTAGVNCEQCAKGYYRPYGVPVDAP
DGCIPCSCDPEHADGCEQGSGRCHCKPNFHGDNCEKCAVGYYNFPFCLKIPIFPVSTPSP
EDPVAGDIRGCDCNPEGVLPEICDAHGRCLCRPGVEGPRCDTCRSGFYSFPICQGKWAKH
GMF
Download sequence
Identical sequences ENSMMUP00000041300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]