SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000041374 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000041374
Domain Number 1 Region: 1-142
Classification Level Classification E-value
Superfamily Globin-like 2.29e-49
Family Globins 0.000000271
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000041374   Gene: ENSMMUG00000032607   Transcript: ENSMMUT00000048339
Sequence length 142
Comment pep:known scaffold:MMUL_1:1099214726946:560:1424:1 gene:ENSMMUG00000032607 transcript:ENSMMUT00000048339 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLSPADKSNVKAAWGKVGGHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG
KKVADALTLAVGHVDDMPQALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTP
AVHASLDKFLASVSTVLTSKYR
Download sequence
Identical sequences G7NQC3
ENSMMUP00000041374 9544.ENSMMUP00000041374 ENSMMUP00000041374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]