SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000041381 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000041381
Domain Number 1 Region: 7-180
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.13e-32
Family DsbA-like 0.000000353
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000041381   Gene: ENSMMUG00000012628   Transcript: ENSMMUT00000048346
Sequence length 190
Comment pep:known scaffold:MMUL_1:1099548049365:34111:39756:1 gene:ENSMMUG00000012628 transcript:ENSMMUT00000048346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPLLRTVELFYDVLSPYSWLGFEVLCRYQNIWNINLQLRPSLIGGIMKDSGNKPPGLLP
RKGQYMANDIKLLRHHFQIPIQFPKDFFSVIIEKGSLSAMRFLTAVSLEHPEMLEKASRE
LWMRVWSRDEDITQPQSILAAAEKAGMSAEQAQGLLEKISTPKVKNQLKETTEAACRYGE
RSGWALCLQL
Download sequence
Identical sequences ENSMMUP00000041381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]