SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|432331067|ref|YP_007249210.1| from Methanoregula formicica Methanoregula formicicum SMSP

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|432331067|ref|YP_007249210.1|
Domain Number 1 Region: 24-277
Classification Level Classification E-value
Superfamily PP2C-like 3.01e-17
Family PP2C-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|432331067|ref|YP_007249210.1|
Sequence length 304
Comment serine/threonine protein phosphatase [Methanoregula formicica SMSP]
Sequence
MPEPRQFLCACDPSLGWAFGCSRTGASHIRLSRPCEDAYAIYSGASGAIPCIAVAIADGH
GDPRHDMSGTGASLAVQAGVDELTGFHRMRVHTVPPHILRSEFKADFPRRITRRWRDYVQ
ADAATHEIARPESDPYIRYGSTLISALIVADTILIGQIGDGDIVLVRPDGTIESPIPPET
RLVGKETHSLSSRDAHLLWRTATLDRENGGVLIAATDGVSDSFDSTAGGEFFTFVKSLVD
RVKDFGIESVAGSMAGWLDRYSELASGDDMTIVFVSINPDESIPPSPIHEPEPDEKAPGL
TECW
Download sequence
Identical sequences L0HHC1
WP_015285666.1.81074 gi|432331067|ref|YP_007249210.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]