SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|432331354|ref|YP_007249497.1| from Methanoregula formicica Methanoregula formicicum SMSP

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|432331354|ref|YP_007249497.1|
Domain Number 1 Region: 510-711
Classification Level Classification E-value
Superfamily PP2C-like 0.00000000000157
Family PP2C-like 0.021
Further Details:      
 
Domain Number 2 Region: 410-460
Classification Level Classification E-value
Superfamily HAMP domain-like 0.0000000000222
Family HAMP domain 0.0032
Further Details:      
 
Domain Number 3 Region: 159-255
Classification Level Classification E-value
Superfamily Sensory domain-like 0.000000000785
Family Sensory domain of two-component sensor kinase 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|432331354|ref|YP_007249497.1|
Sequence length 713
Comment HAMP domain-containing protein,cache domain-containing protein [Methanoregula formicica SMSP]
Sequence
MASSGKSADRFSFSVRTKILLAFLALSLGALLITAFIAFVQMEDTGQYAITSSISLGNRA
SADSTAALERDAQASLLRLAKDQAYISNIIIEQVGDDLNIMAYYAGEIHKNPGMVRDLHL
PTQDERPENPLSTSVVFYSPGAEKTISSEEVQAAGMMTQIFIPVYATDPQTSAVFVGTES
GVSVIYPWTTGLNASFDPRLRSWFIDAKKNGGITWSDPYVDLLGHGLMITCSRPVYDNST
GRLWVVGADVTIETINQKIISTQVGDRGYAMLIDENGNIITRPGLTAGDQRWDASFVTEN
LLQSDNPGLVAVAREMVAGQTGIARVTYEDGDRFIAYAPVTSVNWSVGVVMPVDEVTAPA
RATSTRIDTDTATVAAHIDRQQNTVQAIFLILSIILIVIVGILAYFFAQYLTRPLAALRN
GAEAIGRGDLEYRVQVATQDEFGTLADTFNRMASDLREYISTLKRTTAEKERMLKELEIA
KGIQQSFLPESAPDLPGFDLAGYNLPALEVGGDFYDFIPLDSDHYGLVIADVSGKGVPAA
LFMALSRTLIRASATSVDDPVRSIREANRHIFADSKTSMFVTLFYAVLDCREKSLMFVNA
GHNPPLYLGAGTSNVRLLNAEGIALGVLDEIELKSVTIPLHPGDVVVLYTDGVTEATNEK
DEEYGIERLMQCVEDAKALSSQAIIDAIVHEVVAFAGTHPQHDDITVMVLKVL
Download sequence
Identical sequences L0HG37
gi|432331354|ref|YP_007249497.1| WP_015285953.1.81074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]