SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|432331568|ref|YP_007249711.1| from Methanoregula formicica Methanoregula formicicum SMSP

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|432331568|ref|YP_007249711.1|
Domain Number 1 Region: 406-456
Classification Level Classification E-value
Superfamily HAMP domain-like 0.000000000549
Family HAMP domain 0.0055
Further Details:      
 
Domain Number 2 Region: 507-708
Classification Level Classification E-value
Superfamily PP2C-like 0.00000000209
Family PP2C-like 0.023
Further Details:      
 
Weak hits

Sequence:  gi|432331568|ref|YP_007249711.1|
Domain Number - Region: 187-251
Classification Level Classification E-value
Superfamily Sensory domain-like 0.000298
Family YkuI C-terminal domain-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|432331568|ref|YP_007249711.1|
Sequence length 709
Comment serine phosphatase RsbU, regulator of sigma subunit [Methanoregula formicica SMSP]
Sequence
MTSSWLTLPQCSVRTKILAVFLALSLITLLVTGYVALFTIGSLAETAESGSFRQGLQAVD
MATVALQQSAEQYLLQAAGDQAAIAGTLFNDTETELDLLTVQAATLQGNPPVLPVIRSFG
RNTPPADPRDATVFLFSPGSTVTTDSEEFRKSAGMDDLLKGMYDADEDLVSVFLATDSGI
LRSYPWENTDAENYDPRTRAWFTGAKGTNGVYWSKPYVDSFGHGLVVTSSKAVATPYGTW
VIGSDVRVGVITSEFLNTTLGGRGYAVLMDNSGDIISRPQLAAGDHRWDQPFPQDNVFKS
SDPALVAAGKNMTEGRTGVERVQFNGVDTFVAYAPVPSQNWSVAVCLPVSEVTAPIDRTR
DGITASGRETEEWIAEQSDRVMLLFSLLSFLLLLIVIVLSVALSKAITRPVDTLRQATQA
IGKGDLANRVELRTGDEFEELADSFNRMAGDLRHTIDDLQRTTAEKERYASEMEIAREIQ
QTFLPETIPDIPGFEIAATTIPAMEIGGDLYDFIPQKDGSMGLVIGDVSGKGVSAALYMA
LCRTQIHTCGAGSGEPAEAIDPANRLIYDEGRSNMFITVFYAVLDPRKMMLSYVNAGHNP
PLLIRGDLPVAQMLEGKGIALGVIDDTRAKTSMLPLHHGDLIVLYTDGVTEAFNERDEYY
GEERMTAVITKNRSRPAREIGEALLEDIRLFAGSAPQSDDITFILIKVR
Download sequence
Identical sequences L0HJH0
gi|432331568|ref|YP_007249711.1| WP_015286167.1.81074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]