SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|432331624|ref|YP_007249767.1| from Methanoregula formicica Methanoregula formicicum SMSP

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|432331624|ref|YP_007249767.1|
Domain Number 1 Region: 251-457
Classification Level Classification E-value
Superfamily PP2C-like 0.00000000471
Family PP2C-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|432331624|ref|YP_007249767.1|
Sequence length 459
Comment serine phosphatase RsbU, regulator of sigma subunit [Methanoregula formicica SMSP]
Sequence
MATTILSSLIVLLQLMCVIIVAAYLLTRSRFFPEVLEGRPSVKVQAILIIFFGALSVYGT
VAGFEVNGAFINVRDLGPMLAGLLGGPVIGLGAGLIGAIHRLSVGGFTVYSCSLATVLAG
LFGGLIWLARKRKFAGITIAVIFAIAMETLHMLMTLAICSPFEKALSVVELVSIPMIAAN
AAGMFVFAFIIGNLQNERRMQRERDTLIKEIQRKDTELSIAAEIQQSFLPETMIPLEGFD
IAGRNVMAKEVGGDFFDVIPLEVIPISQHRLGLMIADVSGKGIPAALFMALSRIVVRVNA
SWYPDQPAEAINTANSIISADSKSGMFVTLFYATLNAENRVLTYVNAGHNPPLLYHADGS
FEELEATGMAIGALKEAEYFAGKKTLEKGDILVMYTDGITEAENNRQEMFGETRLRDVIA
RSQGMDSKTMMAKILGEVKAFCGDHPQSDDITLMIIRTE
Download sequence
Identical sequences L0HGY2
WP_015286223.1.81074 gi|432331624|ref|YP_007249767.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]