SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|432331625|ref|YP_007249768.1| from Methanoregula formicica Methanoregula formicicum SMSP

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|432331625|ref|YP_007249768.1|
Domain Number 1 Region: 1-107
Classification Level Classification E-value
Superfamily SpoIIaa-like 3.14e-26
Family Anti-sigma factor antagonist SpoIIaa 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|432331625|ref|YP_007249768.1|
Sequence length 110
Comment anti-anti-sigma factor [Methanoregula formicica SMSP]
Sequence
MEIKTTSKDNATTLSLNGRIDTATAPELEQAINKVIDGGQRKVLLDFAGVTYISSGGLRV
LLATAKKLKNPGDKFGICALTPEVLKILKLAGFTSIFSIYASEGETLAGW
Download sequence
Identical sequences L0HHM2
gi|432331625|ref|YP_007249768.1| WP_015286224.1.81074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]