SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000107 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000107
Domain Number 1 Region: 244-301
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.54e-19
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 300-357
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.32e-19
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 557-609
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.52e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 412-462
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000138
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 5 Region: 360-412
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000022
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 6 Region: 465-518
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000549
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 7 Region: 13-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000000667
Family KRAB domain (Kruppel-associated box) 0.0028
Further Details:      
 
Domain Number 8 Region: 210-258
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000018
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 9 Region: 518-568
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000774
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000107   Gene: ENSMMUG00000000080   Transcript: ENSMMUT00000000117
Sequence length 611
Comment pep:novel chromosome:MMUL_1:14:48001080:48003012:-1 gene:ENSMMUG00000000080 transcript:ENSMMUT00000000117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCIELLRAKREEAFLLFHDVAVDFTQEEWKLLSVAQRTLYRDMMLGTTATWSSCEPFSKP
TLVILVEQGGEPWREESQCLPSSCLVDPNPEIQPCFSSPLAFCSQQLRQNMLHYHHLQGY
PGLDAETLPIMNLCHVDQEKQSPLSYGTIKEKITSRTSSPPKGQLLSSREDNTMGEIKLS
SGRQPQKANPIETEKLLKWAEMPGFEIVSFKNCGLGFNQKSVLFTHQRIHSGGKLYICSK
CRQSFSYQSALVTHKRSHTEKKPYLCPDCGHAFSQKSNLVTHKMAHSGEKPFTCEECRQS
FSQKSNLIRRLRIHSREKPFVCRECGRGFRDKSNLITQQRTHSWEKPYVCRDCGRLFRES
THSKHQRAHSGENPHLCSECGQSFSQESYFIQYKRTHSREKPFVCRECGRGFSDKSNFTT
HQRTHSGENPYMCVECGRGFSVKSAPIAQQRTHSGEKPYVYTGYISQLLLHIRTHSAEKP
YVYKECGRAFRQMSHPFSHQRMCSGEKASVCTECGQGFSQKANLFRQDLSLKGEAVCMQG
FSQKSALIRHQRTHSGKPYVCKECEWGFSDKAALIIHQRTHSGEKSYVCNRCEEGFTLKS
YLIRHQRAHLL
Download sequence
Identical sequences ENSMMUP00000000107 ENSMMUP00000000109 9544.ENSMMUP00000000107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]