SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000108 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000108
Domain Number 1 Region: 244-301
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.75e-21
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 2 Region: 189-245
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.21e-17
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 3 Region: 316-376
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.54e-17
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 4 Region: 480-532
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.85e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 410-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000001
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 6 Region: 7-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000000111
Family KRAB domain (Kruppel-associated box) 0.0028
Further Details:      
 
Domain Number 7 Region: 367-404
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000154
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000000108
Domain Number - Region: 456-479
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0213
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000108   Gene: ENSMMUG00000000080   Transcript: ENSMMUT00000000118
Sequence length 545
Comment pep:novel chromosome:MMUL_1:14:48001029:48002994:-1 gene:ENSMMUG00000000080 transcript:ENSMMUT00000000118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAKREEAFLLFHDVAVDFTQEEWKLLSVAQRTLYRDMMLGTTATWSSCIPFSKPTLVILV
EQGGEPWREESQCLPSSCLGYPGLDAETLPIMNLCHVDQEKQSPLSYSDRVESQDKKQGT
IKEKITSRTSSPPKGQLLSSREDNTMGEIKLSSGRQPQKANPIETEKLLKWAEMPGFEIV
SFKNCGLGFNQKSVLFTHQRIHSGGKLYICSKCRQSFSYQSALVTHKRSHTEKKPYLCPD
CGHAFSQKSNLVTHKMAHSGEKPFTCEECRQSFSQKSNLIRRLRIHSREKPFVCRECGRG
FRERSTHSKHQRAHSGENPHLCSECGQSFSQESYFIQYKRTHSREKPFVCRECGRGFSDK
SNFTTHQRTHSGENPYMCVECGRGFSVKSAPIAQQRTHSGEKPYVYTGCRSQLLLHIRTH
SAEKPYVYKECGRAFRQMSHPFSHQRMCSGEKASVCTECGQGFSQKKSALIRHQRTHSEK
PYVCKECEWGFSDKAALIIHQRTHSGEKSYVCNRCEEGFTLKSYLIRHQRAHLLEYINTC
RQGFS
Download sequence
Identical sequences ENSMMUP00000000108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]