SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000111 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000111
Domain Number 1 Region: 179-236
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.99e-19
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 235-292
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.26e-19
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 306-366
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.52e-18
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 4 Region: 462-511
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.13e-16
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 5 Region: 405-458
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000224
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 145-193
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000146
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 7 Region: 360-404
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000036
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000111   Gene: ENSMMUG00000000080   Transcript: ENSMMUT00000000122
Sequence length 511
Comment pep:novel chromosome:MMUL_1:14:48001137:48002826:-1 gene:ENSMMUG00000000080 transcript:ENSMMUT00000000122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WSFWWSKVDPNPEIQPCFSSPLAFCSQQLRQNMLHYHHLQGYPGLDAETLPIMNLCHVDQ
EKQSPLSYSDRVESQDKKQGSGTIKEKITSRTSSPPKGQLLSSREDNTMGEIKLSSGRQP
QKANPIETEKLLKWAEMPGFEIVSFKNCGLGFNQKSVLFTHQRIHSGGKLYICSKCRQSF
SYQSALVTHKRSHTEKKPYLCPDCGHAFSQKSNLVTHKMAHSGEKPFTCEECRQSFSQKS
NLIRRLRIHSREKPFVCRECGRGFRDKSNLITQQRTHSWEKPYVCRDCGRLFRRSTHSKH
QRAHSGENPHLCSECGQSFSQESYFIQYKRTHSREKPFVCRECGRGFSDKSNFTTHQRTH
SGENPYMCVECGRGFSVKSAPIAQQRTHSGEKPYVYTGCGDALDISQLLLHIRTHSAEKP
YVYKECGRAFRQMSHPFSHQRMCSGEKASVCTECGQGFSQKKSALIRHQRTHSGKPYVCK
ECEWGFSDKAALIIHQRTHSGEKSYVCNRCE
Download sequence
Identical sequences ENSMMUP00000000111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]