SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000215 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000215
Domain Number 1 Region: 261-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.85e-23
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 2 Region: 429-486
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.03e-22
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 373-430
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.42e-22
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 4 Region: 486-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.77e-22
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 205-262
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.02e-21
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 6 Region: 597-654
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.1e-21
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 7 Region: 541-598
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.05e-20
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 8 Region: 4-62
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.27e-19
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 9 Region: 150-206
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.78e-18
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 10 Region: 644-695
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.68e-17
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 11 Region: 95-151
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.39e-16
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 12 Region: 303-352
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000157
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000215   Gene: ENSMMUG00000001930   Transcript: ENSMMUT00000000228
Sequence length 696
Comment pep:known chromosome:MMUL_1:19:44024524:44047925:-1 gene:ENSMMUG00000001930 transcript:ENSMMUT00000000228 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACESITFGDVAIDFSHQEWEYLNLVQKTLYQEVMMENYDNLVSLAGHSISKPDLITLLE
QGKEPWMIVGEETRGECTDLDSRYEIISDGKMHLYRKQSSVTLHQRIHNGQKPYECKECQ
KAFSHLTELIVHQRIHTSEEPDQREEFGKAFSHLTDLREHQKIHAREKPYECEECGKVFS
YPANLAQHGKVHVEKPYECKECGEAFRTSRQLTVHHRFHYGEKPYECKECGKAFSVYGRL
SRHQSIHTGEKPFECNKCGKSFRLKAGLKVHQSIHTGEKPHECKECGKAFRQFSHLVGHK
RIHTGEKPYECKECGKGFTCRYQLTMHQRIYSGEKPYECKENGEAFSSGHQLTAPHTFES
VEKPYKCEECGKAFSVYGRLTRHQGIHSGKKPFECNKCGKSFRLNSSLKIHQNIHTGEKP
YKCKECGKAFSQRAHLAHHNRIHTGYKPFECKECGKSFRCASYLVIHERIHTGEKPYVCQ
ECGKGFSYSHKLTIHRRVHTGEKPYECKECGKAFSVSGQLTQHLSIHSGKKPFECNKCGK
SFRFISVLKAHQNIHSAEKPYECKECGKAFRHATSLIYHDRTHAGEKSYECKECGETFSH
ASHLIIHERIHTSDKPYECKRCGKAFRCASYLVRHERVHADGNPYMCEECGKAFNSSHEL
SIHHRVHTGEKPFKCNKCRRSFRLRSILEVHQRIHI
Download sequence
Identical sequences A0A2K5TJR3 F7HLX0
ENSMMUP00000000215 ENSMMUP00000002577 XP_005589107.1.63531 XP_005589108.1.63531 XP_005589109.1.63531 XP_005589111.1.63531 XP_014979081.1.72884 XP_014979082.1.72884 9544.ENSMMUP00000000215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]