SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000222 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000222
Domain Number 1 Region: 1-85
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2e-23
Family THAP domain 0.00021
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000000222
Domain Number - Region: 135-181
Classification Level Classification E-value
Superfamily Prefoldin 0.00165
Family Prefoldin 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000222   Gene: ENSMMUG00000000162   Transcript: ENSMMUT00000000235
Sequence length 212
Comment pep:known chromosome:MMUL_1:8:43439553:43445394:-1 gene:ENSMMUG00000000162 transcript:ENSMMUT00000000235 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVQSCSAYGCKNRYDKDKPVSFHKFPLTRPSLCKEWEAAVRRKNFKPTKYSSICSEHFTP
DCFKRECNNKLLKENAVPTIFLCTEPHDKKEDLEPQEQLPPPPLPPPVSQVDAAIGLLMP
PLQTPVNLSVFCDHNYTVEDTMHQRKRIHQLEQQVEKLRKKLKTAQQRCRRQERQLEKLK
EVVHFQKEKDDVSERGYVILPNDYFEIVEVPA
Download sequence
Identical sequences A0A096N1X8 A0A2K5KWY1 A0A2K5UT26 A0A2K5YFM1 A0A2K6B9T0 H9FWI5
ENSPANP00000006319 9544.ENSMMUP00000000222 ENSMMUP00000000222 ENSMMUP00000000222 NP_001244808.1.72884 XP_011730789.1.29376 XP_011856430.1.47321 XP_011937362.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]