SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000250 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000250
Domain Number 1 Region: 293-350
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.47e-26
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 2 Region: 349-406
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.1e-26
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 3 Region: 237-294
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.31e-24
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 4 Region: 405-462
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.1e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 1-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.06e-22
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 6 Region: 181-238
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.56e-22
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 7 Region: 143-195
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000016
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000250   Gene: ENSMMUG00000000174   Transcript: ENSMMUT00000000263
Sequence length 470
Comment pep:novel chromosome:MMUL_1:19:20847122:20862167:-1 gene:ENSMMUG00000000174 transcript:ENSMMUT00000000263 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QPSLTFMDVAIEFSLEEWQCLDTAQQNLYRNVMLENYRNLVFLGIVASKPDLITCLEKEK
EPWNMKQHEIVDEPPVMRSHFVEELWPEQNIKDSFQKMILRRYNKCGHKNLQLNKGCRSV
NECKLHKGGYNGLNQCFTTTQSKIFQCYTYIKGFHIFSNSNRPKIRHTGKKPFKCKKCGK
SFCMLSQLTQHERIHTGKKLYKCEECGKAFNWPSILSQHERIHTGEKHYKCEECGKAFKQ
SSSLTRQKRIHTGEKYYKCEECGKAFNRFSNLTMHKIIHTGEKPYKCEECGKAFNQSSIL
TMHKIIHTGEKPYKCEECGKAFNQSSNLIMHKRIHTGEKPYKCEECGKAFNQSSNLTVHK
IIHTGEKPYKCEECGKAFKQSSRLTRHKRIHTGEKPYKCEECGKTFEQSSSLTTHKIIHT
GEKPYKCEECGKAFKQSSNLTKHKRIHTREKPYKCVKCGKAFNQSLTFTK
Download sequence
Identical sequences ENSMMUP00000000250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]