SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000327 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000327
Domain Number 1 Region: 773-954
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.35e-43
Family Ypt/Rab-GAP domain of gyp1p 0.0038
Further Details:      
 
Domain Number 2 Region: 929-1048
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 4.71e-32
Family Ypt/Rab-GAP domain of gyp1p 0.0044
Further Details:      
 
Domain Number 3 Region: 157-192,231-377
Classification Level Classification E-value
Superfamily PH domain-like 5.78e-32
Family Phosphotyrosine-binding domain (PTB) 0.006
Further Details:      
 
Domain Number 4 Region: 3-163
Classification Level Classification E-value
Superfamily PH domain-like 1.13e-20
Family Phosphotyrosine-binding domain (PTB) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000327   Gene: ENSMMUG00000000237   Transcript: ENSMMUT00000000350
Sequence length 1169
Comment pep:known chromosome:MMUL_1:5:32873473:33120916:1 gene:ENSMMUG00000000237 transcript:ENSMMUT00000000350 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPITFTARKHPLPNEVSVDFGLQLVGSLPVHSLTTMPMLPWVVAEVRRLSRQSSRKEPV
TKQVRLCVSPSGLRCEPEPGRSQQWDPLICSSIFECKPQHVHKLIHNSHDPSYFACLIKE
DAVHRQSICHVFKADDQTKVPEIISSIRQAGKIARQEELHCPSEFDDTFSKKFEVLFCGR
VTVAHKKAPPALIDECIEKFNHVSGSLGSESPRPAPPHAAPTGSQEPGRRPMRKSFSQPG
LRSLAFRKELQDGGLRSSGFFSSFEESDIENHLISGHNIVQPTDIEENRTMLFTIGQSEV
YLISPDTKKIALEKNFKEISFCSQGIRHVDHFGFICRESSGGGGFHFVCYVFQCTNEALV
DEIMMTLKQAFTVAAVQQTAKAPAQLCEGCPLQGLHKLCERIEGMNSSKTKLELQKHLTT
LTNQEQATIFEEVQKLRPRNEQRENELIISFLRCLYEEKQKEHIHIGEMKQTSQIAAENI
GSELPPSATRFRLDLLKNKAKRSLTESLESILSRGNKARGLQEHSSSVDLDSSLSSTLSN
TSKEPSVCEKEALPISESSFKLLGSSEDLSSDSESHLPEEPAPLSPQQAFRRRANTLSHF
PMECQEPPQPARGSPGVSQRKLMRYHSVSTETPHERKDFESKANHLGDSGGTPVKTRRHS
WRQQIFLRVATPQKACDASSRYEDYSELGELPPRSPLEPVCEDGPFGPTPEEKKRTSREL
RELWQKAILQQILLLRMEKENQKLQASENDLLNKRLKLDYEEITPCLKEVTTVWEKMLST
PGRSKIKFDMEKMHSAVGQGVPRHHRGEIWKFLAEQFHLKHQFPSKQQPKDVPYKELLKQ
LTSQQHAILIDLGRTFPTHPYFSAQLGAGQLSLYNILKAYSLLDQEVGYCQGLSFVAGIL
LLHMSEEEAFKMLKFLMFDVGLRKQYRPDMIILQIQMYQLSRLLHDYHRDLYNHLEEHEI
GPSLYAAPWFLTMFASQFPLGFVARVFDMIFLQGTEVIFKVALSLLGSHKPLILQHENLE
TIVDFIKNTLPNLGLVQMEKTINQVFEMDIAKQLQAYEVEYHVLQEELIDSSPLSDNQRM
DKLEKTNSSLRKQNLDLLEQLQVANGRIQSLEATIEKLLSSESKLKQAMLTLELERSALL
QTVEELRRGSASPSDLREPECTQPEPTGD
Download sequence
Identical sequences F6XAS8
9544.ENSMMUP00000000327 ENSMMUP00000000327 NP_001244994.1.72884 ENSMMUP00000000327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]