SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000409 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000409
Domain Number 1 Region: 10-297
Classification Level Classification E-value
Superfamily WD40 repeat-like 9.71e-45
Family WD40-repeat 0.0034
Further Details:      
 
Domain Number 2 Region: 1010-1070
Classification Level Classification E-value
Superfamily HMG-box 0.000000223
Family HMG-box 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000409   Gene: ENSMMUG00000000302   Transcript: ENSMMUT00000000441
Sequence length 1125
Comment pep:known chromosome:MMUL_1:7:117959638:118043093:-1 gene:ENSMMUG00000000302 transcript:ENSMMUT00000000441 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPATRKPMRYGHTEGHTEVCFDDSGSFIVTCGSDGDVRIWEDLDDDDPKFINVGEKAYSC
ALKNGKLVTAVSNNTIQVHTFPEGVPDGILTRFTTNANHVVFNGDGAKIAAGSSDFLVKI
VDVMDSSQQKTFRGHDAPVLSLSFDPKDIFLASASCDGSVRVWQISDQTCAISWPLLQKC
NDVINAKSICRLAWQPKSGKLLAIPVEKSVKLYRRETWSHQFDLSDNFISQTLNIVTWSP
CGQYLAAGSINGLIIVWNVETKDCMERVKHEKGYAICGLAWHPTCGRISYTDAEGNLGLL
ENVCDPSGKTSSSKVSSRVEKDYNDLFDGDDMSNTGDFLNDNAVEIPSFSKGIINDDEDD
DLMMASGRLRQRSHILEDDENSVDISMLKTGSSLLKEEEEDGQESSIHNLPLVTSQRPFY
DGPMPTPRQKPFQSGSTPLHLTHRFMVWNSIGIIRCYNDEQDNAIDVEFHDSSIHHATHL
SNTLNYTIADLSHEAILLACESTDELASKLHCLHFSSWDSSKEWIIDLPQNEDIEAICLG
QGWAAAATSALLLRLFTIGGVQKEVFSLAGPVVSMAGHGEQLFIVYHRGTGFDGDQCLGV
QLLELGKKKKQIVHGDPLPLTRKSYLAWIGFSAEGKINLFKKNKYNRKCRYSSRRKLFHC
FIPNFFKDKLSLFYILNFYFNIKFLWCIPCKGSRFPPTLPRPAVAILSFKLPYCQIATEK
GQMEEQFWRSVIFHNHLDYLAKNGYEYEESTKKQATKEQQELLMKMLALSCKLEREFRCV
ELADLMTQNAVNLAIKYASRSRKLILAQKLSELAVEKAAELTATQVEEGEEEDFRKKLNA
GYSNTATEWSQPRFRNQVEEDAEDSGEADDEEKPEIHKPGQNSFSKSTNSSDISAKSGAV
TFSSQGRVNPFKVSASSKEPAMSMNSARSTNILDNMGKSSKKSTALNRTTNNEKSPIIKP
LIPKPKPKQASAASYFQKRNSQTNKTEEVKEENPKNVLSETPAICPQNTENQRPKTGFQM
WLEENRSNILSDNPDFSDEADIIKEGMIRFRVLSTEERKAWANKAKGEKASDGAEAKKRN
RVVDESDETENQEEKTKENLNLPKKQKPLDFSTNQKLSAFAFKQE
Download sequence
Identical sequences ENSMMUP00000000409 9544.ENSMMUP00000000409 ENSMMUP00000000409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]