SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000430 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000430
Domain Number 1 Region: 18-208
Classification Level Classification E-value
Superfamily Kelch motif 3.14e-28
Family Kelch motif 0.0062
Further Details:      
 
Domain Number 2 Region: 190-365
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 1.44e-26
Family Galactose oxidase, central domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000430   Gene: ENSMMUG00000000319   Transcript: ENSMMUT00000000464
Sequence length 1579
Comment pep:known_by_projection chromosome:MMUL_1:X:152073884:152092368:-1 gene:ENSMMUG00000000319 transcript:ENSMMUT00000000464 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASAVSPANSPAVLLQPRWKRVVGWSGPVPRPRHGHRAVAIKELIVVFGGGNEGIVDELH
VYNTATNQWFIPAVRGDIPPGCAAYGFVCDGTRLLVFGGMVEYGKYSNDLYELQASRWEW
KRLKAKTPKNGPPPCPRLGHSFSLVGNKCYLFGGLANDSEDPKNNIPRYLNDLYILELRP
GSGVVAWDIPITYGVLPPPRESHTAVVYTEKDNKKSKLVIYGGMSGCRLGDLWTLDIDTL
TWNKPSLSGVAPLPRSLHSATTIGNKMYVFGGWVPLVMDDVKVATHEKEWKCTNTLACLN
LDTMAWETILMDTLEDNIPRARAGHCAVAINTRLYIWSGRDGYRKAWNNQVCCKDLWYLE
TEKPPPPARVQLVRANTNSLEAAPAPPTTTTIQVLPTVPGSSISVPTAARTQGVPAVLKV
TGPQATTGTPLVTMRPTSQAGKAPVTVTSLPAGVRMVVPTQSAQGTVIGSSPQMSGMAAL
AAAAAATQKIPPSSAPTVLSVPAGTTIVKTMAVTPGTTTLPATVKVASSPVMVSNPATRM
LKTAAAQVGTSVSSATNTSTRPIITVHKSGTVTVAQQAQVVTTVVGGVTKTITLVKSPIS
VPGGSALISNLGKVMSVVQTKPVQTSAVTGQASTGPVTQIIQTKGPLPAGTILKLVTSAD
GKPTTIITTTQASGAGTKPTILGISSVSPSTTKPGTTTIIKTIPMSAIITQAGATGVTSS
PGIKSPITIITTKVMTSGTGAPAKIITAVPKIATGHGQQGVTQVVLKGAPGQPGTILRTV
PMGGVRLVTPVTVSAVKPAVTTLVVKGTTGVTTLGTVTGTVSTSLAGAGGHSTSASLATP
ITTLGTIATLSSQVINPTAITVSAAQTTLTAAGGLTTPTITMQPVSQPTQVTLITAPSGV
EAQPVHDLPVSILASPTTEQPTATVTIADSGQGDVQPGTVTLVCSNPPCETHETGTTNTA
TTTVVANLGGHPQPTQVQFVCDRQEAAASLVTSTVGQQNGSVVRVCSNPPCETHETGTTN
TATTATSNMAGQHGCSNPPCETHETGTTNTATTAMSSVGANHQRDARRACAAGTPAVIRI
SVATGALEAAQGSKPQCQTRQTSTTSTTMTVMATGAPCSAGPLLGPSMAREPGGRGPAFV
QLAPLSSKVRLSSPGSKDLPAGRHSHVANTTAMARSSMGAGEPRTAPACESLQGGSPSTT
VTVTALEALLCPSATVTQVCSNPPCETHETGTTNTATTSNAGSAQRVCSNPPCETHETGT
THTATTATSNGGTGQPEGGQQPPAGHPCETHQTTSTGTTMSVSMGALLPDATSSHRTLES
GLEVAAAPSVTPQAGTALLAPFPTQRVCSNPPCETHETGTTHTATTVTSNMSSNQDPPPA
ASDQGEVESTQGDSVNITSSSAITTTVSSTLTRAVTTVTQSTPVPGPSVPPPEELQVSPG
PRQQLPPRQLLQSASTALMGESTEVLSASQTPELPAAVDLSSTGEPSSGQESASSAVVAT
VVVQPPPPAQSEVDQLSLPQELMAEAQAGTTTLMVTGLTPEELAVTAAAEAAAQAAATEE
AQALAIQAVLQAAQQAVMG
Download sequence
Identical sequences ENSMMUP00000000430 9544.ENSMMUP00000000430 ENSMMUP00000000430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]