SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000560 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000560
Domain Number 1 Region: 669-816,850-897
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.06e-32
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 2 Region: 52-192,265-334
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4e-30
Family Voltage-gated potassium channels 0.015
Further Details:      
 
Domain Number 3 Region: 1113-1191
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000000000353
Family Voltage-gated potassium channels 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000560   Gene: ENSMMUG00000000415   Transcript: ENSMMUT00000000609
Sequence length 1198
Comment pep:known chromosome:MMUL_1:11:48814959:48906680:1 gene:ENSMMUG00000000415 transcript:ENSMMUT00000000609 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLSPQTFVVLNRGKTLFRFSATPALYILSPFNLIRRIAIKILIHSYPFLQIMIIMCTILT
NCVFMTFSNPPDWSKNVEYTFTGIYTFESLVKIIARGFCIDGFTFLRDPWNWLDFSVIMM
AYITEFVNLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSV
FALIGLQLFMGNLRNKCVVWPINFNESYLENGTKGFDWEEYINNKTNFYTVPGMLEPLLC
GNSSDAGQCPEGYQCMKAGRNPNYGYTSFDTFSWAFLALFRLMTQDYWENLYQLTLRAAG
KTYMIFFVLVIFVGSFYLVNLILAVVAMAYEEQNQATLEEAEQKEAEFKAMLEQLKKQQE
EAQAAAMATSAGTVSEDAIEEEGEEGGGSPRSSSEISKLSSKSAKERRNRRKKRKQKELS
EGEEKGDPEKVFKSESEDGMRRKAFRLPDNRIGRKFSIMNQSLLSIPGSPFLSRHNSKSS
IFSFRGPGRFRDPGSENEFADDEHSTVEESEGRRDSLFIPIRARERRSSYSGYSGYSQGS
RSSRIFPSLRRSVKRNSTVDCNGVVSLIGGPGSHIGGRLLPEATTEVEIRKKGPGSLLVS
MDQLASYGRKDRINSIMSVVTNTLVEELEESQRKCPPCWYKFANTFLIWECHPYWIKLKE
IVNLIVMDPFVDLAITICIVLNTLFMAMEHHPMTPQFEHVLAVGNLVFTGIFTAEMFLKL
IAMDPYYYFQEGWNIFDGFIVSLSLMELSLADVEGLSVLRSFRLLRVFKLAKSWPTLNML
IKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECVCKINQDCELPRWHMHDFFH
SFLIVFRVLCGEWIETMWDCMEVAGQAMCLIVFMMVMVIGNLVVLNLFLALLLSSFSADN
LAATDDDGEMNNLQISVIRIKKGVAWTKLKVHAFMQAHFKQREADEVKPLDELYEKKANC
IANHTGADIHRNGDFQKNGNGTTSGIGSSVEKYIIDEDHMSFINNPNLTVRVPIAVGESD
FENLNTEDVSSESDPEGSKDKLDDTSSSEGSTIDIKPEVEEVPVEQPEEYLDPDACFTEG
CVQRFKCCQVNIEEGLGKSWWILRKTCFLIVEHNWFETFIIFMILLSSGALAFEDIYIEQ
RKTIRTILEYADKVFTYIFILEMLLKWTAYGFVKFFTNAWCWLDFLIVAVPLNLSGLI
Download sequence
Identical sequences ENSMMUP00000000560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]