SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000908 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000908
Domain Number 1 Region: 36-115
Classification Level Classification E-value
Superfamily HMG-box 7.99e-30
Family HMG-box 0.0000071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000908   Gene: ENSMMUG00000000675   Transcript: ENSMMUT00000000970
Sequence length 319
Comment pep:known chromosome:MMUL_1:2:104986762:104987721:-1 gene:ENSMMUG00000000675 transcript:ENSMMUT00000000970 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYNMMETELKPPGPQQTSGGGGGGGNSTAAAAGGNQKNSPDRVKRPMNAFMVWSRGQRRK
MAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKT
LMKKDKYTLPGGLLAPGGNSMASGVGVGAGLGAGVNQRMDSYAHMNGWSNGSYSMMQDQL
GYPQHPGLNAHGAAQMQPMHRYDVSALQYNSMTSSQTYMNGSPTYSMSYSQQGTPGMALG
SMGSVVKSEASSSPPVVTSSSHSRAPCQAGDLRDMISMYLPGAEVPEPAAPSRLHMSQHY
QSGPVPGTAINGTLPLSHM
Download sequence
Identical sequences A0A0D9SC13 A0A2K5KW19 A0A2K5UL35 A0A2K6B307 A0A2K6NEL0 B8XIA2 G1SBA9 H0Y203 H2PC44 H2R486
ENSNLEP00000022803 ENSPPYP00000016027 ENSMMUP00000000908 9544.ENSMMUP00000000908 9600.ENSPPYP00000016027 ENSOGAP00000022396 NP_001136412.1.72884 XP_002814367.1.23681 XP_003800142.1.62490 XP_005546525.1.63531 XP_007970196.1.81039 XP_010361825.1.97406 XP_011736823.1.29376 XP_011944158.1.92194 XP_012366121.1.23891 XP_014987015.1.72884 XP_014987016.1.72884 XP_516895.4.37143 ENSOGAP00000022396 ENSNLEP00000022803 ENSPPYP00000016027 ENSMMUP00000000908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]