SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001034 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001034
Domain Number 1 Region: 554-611
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-20
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 2 Region: 600-652
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.8e-19
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 3 Region: 516-568
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.45e-16
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 194-248
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.81e-16
Family KRAB domain (Kruppel-associated box) 0.0026
Further Details:      
 
Domain Number 5 Region: 402-442
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0000523
Family beta-sandwich domain of Sec23/24 0.013
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000001034
Domain Number - Region: 92-173
Classification Level Classification E-value
Superfamily Tropomyosin 0.0196
Family Tropomyosin 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001034   Gene: ENSMMUG00000000767   Transcript: ENSMMUT00000001103
Sequence length 671
Comment pep:known chromosome:MMUL_1:3:186511650:186540786:1 gene:ENSMMUG00000000767 transcript:ENSMMUT00000001103 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQFVSTRPQPQQLGIQGLGLDSGSWSWAQALPPEEVCHQEPALRGEMAEGMPPMQAQEWD
MDARRPMPFQFPPFPDRAPVFPDRMMREPQLPTAEISLWTVVAAIQAVERKVDAQASQLL
NLEGRTGTAEKKLADCEKTAVEFGNHMESKWAVLGTLLQEYGLLQRRLENLENLLRNRNF
WVLRLPPGSKGEAPKVPVTFVDIAVYFSEDEWKNLDEWQKELYNNLVKENYKTLMSLDAE
GPVPKPDAPTQPEPREEPCVWEQRHPEEREISMDPDAGAEPLVPVQDASSQVKREDALCV
RGQRGLEERAIPTESITDSPISAQDLLSRIKQEEHQCVWDQQDLADRDIPTDPNSESLIS
AHDILSWIKQEEQPYPWGPRDSMDGELGLDSGPSDSLLMVKNPPPAPPQPQPQPQPPQPQ
PQSQPQPQSLPPIAVAENPGGPPSRGLLDDGFQALPGERGSGEAPLGGDRSTGGGGGDGG
GGGGGAEVGTGAGGGCGSCCPGGLRRSLLLHGARSKPYSCPECGKSFGVRKSLIIHHRSH
TKERPYECAECEKSFNCHSGLIRHQMTHRGERPYKCSECEKTYSRKEHLQNHQRLHTGER
PFQCALCGKSFIRKQNLLKHQRIHTGERPYTCGECGKSFRYKESLKDHLRVHSGGPGPGA
PRPLPPPPERD
Download sequence
Identical sequences F6RJ75
ENSMMUP00000001034 ENSMMUP00000001034 9544.ENSMMUP00000001034 XP_001098866.2.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]