SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001035 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001035
Domain Number 1 Region: 71-319
Classification Level Classification E-value
Superfamily Kelch motif 2.62e-56
Family Kelch motif 0.01
Further Details:      
 
Domain Number 2 Region: 11-69
Classification Level Classification E-value
Superfamily Kelch motif 0.0000000432
Family Kelch motif 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001035   Gene: ENSMMUG00000000766   Transcript: ENSMMUT00000001104
Sequence length 391
Comment pep:known chromosome:MMUL_1:4:42903657:42910599:1 gene:ENSMMUG00000000766 transcript:ENSMMUT00000001104 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRWTVHLEGGPRRVNHAAVAVGHRVYSFGGYCSGEDYETLRQIDVHIFNAVSLRWTKLP
PVKSAIRGQAPVVPYMRYGHSTVLIDDTVLLWGGRNDTEGACNVLYAFDVNTHKWFTPRV
SGTVPGARDGHSACVLGKIMYIFGGYEQQADCFSNDIHKLDTSTMTWTLICTKGNPARWR
DFHSATMLGSHMYVFGGRADRFGPFHSNNEIYCNRIRVFDTRTEAWLDCPPTPVLPEGRR
SHSAFGYNGELYIFGGYNARLNRHFHDLWKFNPVSFTWKKIEPKGKGPCPRRRQCCCIVG
DKIVLFGGTSPSPEEGLGDEFDLIDHSDLHILDFSPSLKTLCKLAVIQYNLDQSCLPHDI
RWELNAMTTNSNISRPIVSSPFAYPVPLLEP
Download sequence
Identical sequences G7MPD2 G7P3Z0
9544.ENSMMUP00000001035 ENSMMUP00000033669 ENSMMUP00000001035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]