SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001152 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001152
Domain Number 1 Region: 30-205
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.41e-38
Family SPRY domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001152   Gene: ENSMMUG00000000859   Transcript: ENSMMUT00000001227
Sequence length 207
Comment pep:known_by_projection chromosome:MMUL_1:11:53557197:53558665:1 gene:ENSMMUG00000000859 transcript:ENSMMUT00000001227 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLFARSLRLCRWGAKRLGVASTEAQRGVSFKLEEKTAHSSLALFRGDTGVKYGLVGLE
PTKVALNVERFREWAVVLADTAVTSGRHYWEVTVKRSQQFRIGVADVDMSRDSCIGIDDR
SWVFTYAQRKWYTMLANEKAPIEGIGQPEKVGLLLEYEAQKLSLVDVSQVSVVHTLQTDF
RGPVVPAFALWDGELLTHSGLEVPPGL
Download sequence
Identical sequences F6TG20
9544.ENSMMUP00000001152 ENSMMUP00000001152 NP_001181604.1.72884 ENSMMUP00000001152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]