SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001470 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001470
Domain Number 1 Region: 652-709
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.24e-25
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 2 Region: 400-457
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.81e-25
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 3 Region: 344-401
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.12e-25
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 4 Region: 484-541
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.52e-25
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 5 Region: 288-345
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.09e-24
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 6 Region: 596-653
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.49e-24
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 7 Region: 708-765
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 8 Region: 3-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.45e-24
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 9 Region: 540-597
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.35e-24
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 10 Region: 250-302
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.94e-21
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 11 Region: 764-813
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.22e-18
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 12 Region: 447-479
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000774
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001470   Gene: ENSMMUG00000001106   Transcript: ENSMMUT00000001564
Sequence length 813
Comment pep:known chromosome:MMUL_1:19:59174471:59182056:-1 gene:ENSMMUG00000001106 transcript:ENSMMUT00000001564 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IRLTFRDVAIEFSQEEWKCLDPAQRTLYRDVMLENYWNLVSLGLCHFDMNIISMLEEGKE
PWTVKNCVKIARKPRMRECVKGVITDIPPKCTTKDLLPEEKSSTEAVFHTVMLERHESPD
IEDFSFKELQKNMHDFECQWRDDTGNYKGVLMTQKERKRDQRDKRDVENKLINNQLGVSF
HSHLPELQLFQGEGKMYECKQVEKSTNNGSSVSPLQQIPSSVQTHRSKKYHELNHFSLLT
QRRKANSCGKPYKCNECGKAFTQNSNLTSHRRIHSGEKPYKCSECGKTFTVRSNLTIHQV
IHTGEKPYKCHECGKVFRHNSYLATHRRIHTGEKPYKCNECGKAFRGHSNLTTHQLIHTG
EKPFKCNECGKLFTQNSHLISHWRIHTGEKPYKCNECGKAFSVRSSLAIHQTIHTGEKPY
KCNECGKVFRYNSYLGRHRRVHTGEKPYKCNECGKAFSMHSNLATHQVIHTGTKPFKCNE
CSKVFTQNSQLANHRRIHTGEKPYKCNECGKAFSVRSSLTTHQAIHSGEKPYKCIECGKS
FTQKSHLRSHRGIHSGEKPYKCNECGKVFAQTSQLARHWRVHTGEKPYKCNDCGRAFSDR
SSLTFHQAIHTGEKPYKCHECGKVFRHNSYLATHRRIHTGEKPYKCNECGKAFSMHSNLT
THKVIHTGEKPYKCNECGKVFTQNSHLANHQRTHTGEKPYRCNECGKAFSVRSSLTTHQA
IHTGKKPYKCNECGKVFTQNAHLANHRRIHTGEKPYRCTECGKAFRVRSSLTTHMAIHTG
EKRYKCNECGKVFRQSSNLASHHRMHTGEKPYK
Download sequence
Identical sequences A0A1D5QIH3
9544.ENSMMUP00000001470 ENSMMUP00000001470 ENSMMUP00000001470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]