SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001679 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001679
Domain Number 1 Region: 466-523
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6e-26
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 522-579
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2e-25
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 410-467
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2e-25
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 4 Region: 242-299
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.14e-25
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 5 Region: 23-81
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.32e-25
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 6 Region: 298-355
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.05e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 7 Region: 354-411
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.06e-22
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 8 Region: 566-625
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.98e-22
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 9 Region: 204-256
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000179
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001679   Gene: ENSMMUG00000001258   Transcript: ENSMMUT00000001782
Sequence length 639
Comment pep:known chromosome:MMUL_1:X:45794477:45806947:-1 gene:ENSMMUG00000001258 transcript:ENSMMUT00000001782 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPASASGEASGSFYSWQKAKREQGLVTFEDVAVDFTQEEWQYLNPPQRTLYRDVMLETY
SNLVFVGQQVTKPNLILKLEVEEYPAEGKIPFWNFPEVCQVDEQIERQHQDDQDKRLLMQ
VGFSDKKTITTKSGRDCHEFGNILHLSTNLVASIQRPDKHESFGNNMVDNLDLFSRRSAE
NKYDNGCAKLFFHTEYEKTNPGVKPYGYKECGKGLRRKKGLSLHQRIKNGEKPFECTACR
KTFSKKSHLIVHWRTHTGEKPFGCTECGKAFSQKSQLIIHLRTHTGERPFECPECGKAFR
EKSTVIIHYRTHTGEKPYECNECGKAFTQKSNLIVHQKTHTGEKTYECTKCGESFIQKLD
LIIHHSTHTGKKPHECNECKKTFSDKSTLIIHQRTHTGEKPHKCTECGKSFNEKSTLIVH
QRTHTGEKPYECDVCGKTFTQKSNLGVHQRTHSGEKPFECNECEKAFSQKSYLMLHQRGH
TGEKPYECNECEKAFSQKSYLIIHQRTHTEEKPYKCNECGKAFREKSKLIIHQRIHTGEK
PYECPVCWKAFSQKSQLIIHQRTHTGEKPYACAECGKAFREKSTFTVHQRTHTGEKPYKC
TECGKAFTQKSNLIVHQRTHTGKKAHGRGHTRKSKFMAH
Download sequence
Identical sequences A0A2K5WEA2 F7D328
ENSMMUP00000001679 XP_014982790.1.72884 XP_015299099.1.63531 ENSMMUP00000001679 9544.ENSMMUP00000001679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]