SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001869 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001869
Domain Number 1 Region: 2-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.84e-23
Family KRAB domain (Kruppel-associated box) 0.0006
Further Details:      
 
Domain Number 2 Region: 430-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-22
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 3 Region: 290-347
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.42e-22
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 4 Region: 375-431
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.43e-21
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 5 Region: 234-291
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.46e-18
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 6 Region: 474-528
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.11e-16
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 7 Region: 178-235
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000362
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 8 Region: 337-369
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000563
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 9 Region: 138-188
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000396
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000001869
Domain Number - Region: 85-138
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.013
Family Classic zinc finger, C2H2 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001869   Gene: ENSMMUG00000001400   Transcript: ENSMMUT00000001982
Sequence length 531
Comment pep:known chromosome:MMUL_1:19:11890359:11900446:-1 gene:ENSMMUG00000001400 transcript:ENSMMUT00000001982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMFQDSVAFEDVAVSFTQDEWALLDPSQKNLYRDVMQETFKNLTSVGKTWKIQNMEDKYK
NPRNLSLMREKLFESKESHHCGESFNQIADDMLNKKTLPEVIPCESSVCGEVGMGHSSLN
RHIRADTGHKSSEYQEYGENPYRNKECKKAFSYLDSFQSHDEACTKEKPYDGKECAETFI
SHSCIQRHKVMHREDGPYKCKFCGNTFFFLSLCLIHERIHTAVKPYECKQCGKAFTRSTT
LPIHERTHTEVKADACKECGNAFSFPSEIRRHKRSHAGEKPYECKQCGKVFISFSSIQYH
KMTHTGEKPYECKQCGKAFRCGSHLQKHGRTHTGEKPYECRQCGKAFRCTSDLQRHEKTH
TGDKPYGCKQCGRGFRCASQLQIHERMHSGEKPHECKECGKVFKYFSSLHIHERTHTGEK
PHECKQCGKAFRYFSSLHIHERTHTGDKPYVCKVCGKAFTCSSSIRYHERTHTGEKPYQC
KHCGKAFISNYIRYHERTHTGEKPYQCKHCGKAFIRASSCREHERTHTINI
Download sequence
Identical sequences F7CVC5
ENSMMUP00000001869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]