SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001871 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001871
Domain Number 1 Region: 1-60
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.94e-23
Family KRAB domain (Kruppel-associated box) 0.0006
Further Details:      
 
Domain Number 2 Region: 429-486
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.59e-22
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 3 Region: 289-346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.5e-22
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 4 Region: 374-430
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.35e-21
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 5 Region: 233-290
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.42e-18
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 6 Region: 177-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000344
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 7 Region: 475-514
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000109
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 8 Region: 336-368
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000531
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 9 Region: 137-187
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000399
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000001871
Domain Number - Region: 84-137
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0138
Family Classic zinc finger, C2H2 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001871   Gene: ENSMMUG00000001400   Transcript: ENSMMUT00000001984
Sequence length 533
Comment pep:known chromosome:MMUL_1:19:11890359:11894704:-1 gene:ENSMMUG00000001400 transcript:ENSMMUT00000001984 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFQDSVAFEDVAVSFTQDEWALLDPSQKNLYRDVMQETFKNLTSVGKTWKIQNMEDKYKN
PRNLSLMREKLFESKESHHCGESFNQIADDMLNKKTLPEVIPCESSVCGEVGMGHSSLNR
HIRADTGHKSSEYQEYGENPYRNKECKKAFSYLDSFQSHDEACTKEKPYDGKECAETFIS
HSCIQRHKVMHREDGPYKCKFCGNTFFFLSLCLIHERIHTAVKPYECKQCGKAFTRSTTL
PIHERTHTEVKADACKECGNAFSFPSEIRRHKRSHAGEKPYECKQCGKVFISFSSIQYHK
MTHTGEKPYECKQCGKAFRCGSHLQKHGRTHTGEKPYECRQCGKAFRCTSDLQRHEKTHT
GDKPYGCKQCGRGFRCASQLQIHERMHSGEKPHECKECGKVFKYFSSLHIHERTHTGEKP
HECKQCGKAFRYFSSLHIHERTHTGDKPYVCKVCGKAFTCSSSIRYHERTHTGEKPYQCK
HCGKAFISNYIRYHERTHTGEKPYQCKHCGKAFIPVHVENMKELIPLIYEKSC
Download sequence
Identical sequences ENSMMUP00000001871 ENSMMUP00000001871 9544.ENSMMUP00000001871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]