SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001905 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001905
Domain Number 1 Region: 330-510
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.32e-36
Family Laminin G-like module 0.0028
Further Details:      
 
Domain Number 2 Region: 55-145
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000585
Family Cadherin 0.0046
Further Details:      
 
Domain Number 3 Region: 606-643
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000166
Family EGF-type module 0.0067
Further Details:      
 
Domain Number 4 Region: 531-569
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000126
Family EGF-type module 0.0062
Further Details:      
 
Domain Number 5 Region: 568-611
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000134
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 3-61
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000585
Family Cadherin 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000001905
Domain Number - Region: 300-339
Classification Level Classification E-value
Superfamily EGF/Laminin 0.039
Family Laminin-type module 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001905   Gene: ENSMMUG00000001421   Transcript: ENSMMUT00000002019
Sequence length 1097
Comment pep:known chromosome:MMUL_1:14:91425791:91477119:1 gene:ENSMMUG00000001421 transcript:ENSMMUT00000002019 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EEFVLDSHGILRSAVVFQHTESPEYVLCVQAKDSGKPQQVSHTYIRVRVIEESTHKPTAI
PLEIFIVTMEDDFPGGVIGKIHATDQDMYDVLTFALKSEQKSLFKVNSHDGKIIALGGLD
SGKYVLNVSVSDGRFQVPIDVVVHVEQLVHEMLQNTVTIRFENVSPEDFVGLHMHGFRRT
LRNAVLTQKQDSLHIISIQPVAGTNQLDMLFAVEMHSNEFYKPAYLIQKLSNARRHLENI
MRISAILEKNCSGLDCQEQHCEQGLSLDSHALMTYSTARISFVCPRFYRNVRCTCNGGLC
PGSNDPCVEKPCPGDMQCVGYEASRRPFLCQCPPGKLGECSGHTSLSFAGNSYIKYRLSE
NSKEEDFKLALRLRTLQSNGIIMYTRANPCIILKIVDGKLWFQLDCGSGPGILGISGRAV
NDGSWHSVFLELNRNFTSLSLDDSYVERRRAPLYFQTLSTESSIYFGALVQADNIRSLTD
TRVTQVLSGFQGCLDSVILNNNELPLQNKRSSFAEVVGLTELKLGCVLYPDACERSPCQH
GGSCTGLPSGGYQCTCLSQFTGRNCESEITACFPNPCRNGGSCDPIGNTFICNCKAGLTG
VTCEEDINECEREECENGGSCVNVFGSFLCNCTPGYVGQYCGLRPVVVPNIQAGHSYVGK
EELIGIAVVLFVIFILVVLFIVFRKKVFRKNYSRNNITLVQDPATAALLNKSNGIPFRNL
RGSGDGRNVYQEVGPPQVPVRPMAYTPCFQSDSRSNLDKIVDGLGGEHQEMTTFHPESPR
ILTARRGVVVCSVAPNLPAVSPCRSDCDSIRKNGWDAGTENKAVDDPGEVTCFAGSNKGS
NSEVQSLSSFQSDSGDDNASIVTVIQLVNNVVDTIENEVSVMDQGQNYNRAYHWDTSDWM
PGARLSDIEEVPNYENQDGGSAHQGSTRELESDYYLGGYDIDSEYPPPHEEEFLSQDQLP
PPLPEDFPDQYEALPPSQPVSLASTLSPDCRRRPQFHPSQYLPPHPFPNETDLVGPPASC
EFSTFTVSMNQGTEPTGPADSVSLSLHNSRGTSSSDVSANCGFDNSEVAMSDYESVGELS
LASLHIPFVETQHQTQV
Download sequence
Identical sequences ENSMMUP00000001905 ENSMMUP00000001905 9544.ENSMMUP00000001905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]