SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001941 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001941
Domain Number 1 Region: 483-540
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.98e-25
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 2 Region: 315-372
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.5e-25
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 3 Region: 203-260
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.55e-25
Family Classic zinc finger, C2H2 0.0021
Further Details:      
 
Domain Number 4 Region: 427-484
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.55e-24
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 5 Region: 259-316
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.54e-23
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 6 Region: 539-596
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.63e-22
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 7 Region: 6-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.57e-20
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 8 Region: 581-633
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4e-20
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 9 Region: 371-428
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.2e-20
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 10 Region: 166-217
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.6e-19
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001941   Gene: ENSMMUG00000001457   Transcript: ENSMMUT00000002056
Sequence length 639
Comment pep:known_by_projection chromosome:MMUL_1:11:134207953:134216716:-1 gene:ENSMMUG00000001457 transcript:ENSMMUT00000002056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IVLFQISFEDVAVDFTLEEWQLLNPTQKNLYRDVMLENYSNLIFLEVWLDNPKMWLRDNQ
DNLKSMERGHKYDVFGKIFNSNINVVHVGMRSHKCGTGEKSLKRPFDLLIPRNNGERKKI
DELNNKLLFCIHDRTHCGIKCCDCNTCRKPSNKEPWLTANHTHTGVYLCMECGRFFNKKS
QLIIHQRTHTGEKPYQCSECGKAFSQKSLLTIHQRTHSGEKPYGCSECQKAFSRKSLLIL
HQRIHTGEKPYGCSECGKAFSRKSQLKRHQITHTIEKPYSCSECGKAFSQKLKLITHQRT
HTGEKPYTCSHCGKSFFWKSQLITHQRTHTGKKPYACSECQKAFSRNSLLIRHQRIHTGE
KPYECNECGEAFIRKPQLIKHQITHTGEKNYRCSDCEEAFFKKSELIRHQKIHLGEKPYG
CIQCGKTFFGKSQLLTHHRTHTGEKPYECSECGKAFTQKSSLISHQRTHTGEKPYECSEC
RKTFSEKSSLIHHQRTHTGEKPFECSECRKAFAWKPQLLRHQRIHTGEKPYECNECGKAF
VQKVQLIKHQRNHTGEKTYGCSDCAKAFFEKAQLIIHQRIHTGERPYKCGECGKSFTRKS
HLMRHQRIHTGDKYYGCNECGTTFNRKSQLMIHQRNHII
Download sequence
Identical sequences ENSMMUP00000001941 9544.ENSMMUP00000001941 ENSMMUP00000001941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]