SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001949 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001949
Domain Number 1 Region: 3-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.96e-26
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 2 Region: 495-552
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.62e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 383-440
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.9e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 4 Region: 273-329
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.44e-24
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 5 Region: 607-664
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.4e-23
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 6 Region: 329-384
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.73e-21
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 7 Region: 552-608
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.24e-19
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 8 Region: 439-496
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.73e-19
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 9 Region: 663-717
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.63e-19
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 10 Region: 217-273
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000256
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000001949
Domain Number - Region: 128-176
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0179
Family Classic zinc finger, C2H2 0.062
Further Details:      
 
Domain Number - Region: 164-217
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.065
Family Classic zinc finger, C2H2 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001949   Gene: ENSMMUG00000001462   Transcript: ENSMMUT00000002064
Sequence length 717
Comment pep:known chromosome:MMUL_1:9:37960250:37973227:1 gene:ENSMMUG00000001462 transcript:ENSMMUT00000002064 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NVLFQGSLSFEDVTVGFTQEEWQHLDPAQRTLYRDVMIENYSHLVSVGYCIPKQEVIFKL
EQGEQPWILEEELPVTLCDNARRWADLLQNHFDSQSIQSALLLPQCYETSTFLSLINHSS
DIFLLKIPCKCDLCGMSLKYISDLFSSKKNYLRKMPHDLSAYRKLFLNSNHEKTHMEEKR
YEFIQIGKCLSHKEDFISYLKIQNLEQSEYKECEKDFYGKAVFITYKQAYTGESPCVHNE
CNKVFYNNPTLTVHKITHRGEEVYGCEQCGKPFYEQSKLTKHQRIHTGEKPYECNECEKC
FSRKSPLTLHQRVHTGEKPYKCKECGKCFSRNSHLILHQRTHTGEKPYKCKECRKSFFHK
SYLTVHQRIHMGEPYECNQCGKTFISNSVLIIHHKTHTGEKPCECNECGKSFSRSSYLII
HQRTHTGEKPYECKICGKTFCHKSDVTKHQKTHIGGKPYECIQCGKTFSHNSGLKVHQRT
HTKEKPYEYTEYGKSFSEKSVLTVHQRIHTGEKPYKCNECGKTFYNKSDLTKHQRTHTGK
KPYRCKECGKFFSRNSYLTIHQRMHTGDKPFVCKKCGKTLYHKADYTVHKRTHRGEKSYY
CNECGKTFICNSVLNSHQRKHMGEKPYGCNECGKSFSEKSVLTVHQRIHTGEKPYKCNEC
GKYYHKSDLTKHQRTHTREKPYECSQCGKSFSCSLGLKVYQRRHTREKPYGCKQCGE
Download sequence
Identical sequences ENSMMUP00000001949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]