SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001990 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001990
Domain Number 1 Region: 316-394
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 5.76e-21
Family Intermediate filament protein, coiled coil region 0.00087
Further Details:      
 
Domain Number 2 Region: 82-116
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000785
Family Intermediate filament protein, coiled coil region 0.0024
Further Details:      
 
Domain Number 3 Region: 129-229
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000654
Family Myosin rod fragments 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001990   Gene: ENSMMUG00000001497   Transcript: ENSMMUT00000002107
Sequence length 459
Comment pep:known_by_projection chromosome:MMUL_1:16:50894548:50899914:-1 gene:ENSMMUG00000001497 transcript:ENSMMUT00000002107 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVRFSSTSRRLGSCGGAGSVRLSSGGAGFGAGNTCSVPGIGSGFSCAFGGSSSAGGYGG
GLGGGSASCAAFTGNEHGLLSGNEKVTMQNLNDRLASYLENVRALEEANADLEQKIKGWY
EKFGPGSCRGLDHDYSRYFPIIDELKNQIISATTSNAHVVLQNDNARLTADDFRLKFENE
LALHQSVEADINGLRRVLDELTLCRTDLEIQLETLSEELAYLKKNHEEEMKALQCAAGGN
VNVEMNAAPGVDLTVLLNNMRAEYEALAEQNRRDAEAWFNEKSASLQQQISDDAGATTSA
RNELTEMKRTLQTLEIELQSLLATKHSLEGSLTETESNYCAQLAQIQAQIGALEEQLHQV
RTETEGQKLEYEQLLDVKVHLEKEIETYCLLIDGEDGSCSKSKGYGGPGNQTKDSSKTTI
VKTVVEEIDPRGKVLSSRVHTVEEKATKVNNKNEQRVPS
Download sequence
Identical sequences A0A2K5U5P7 A0A2K6BB16 F7B5M7
ENSMMUP00000001990 ENSMMUP00000001990 9544.ENSMMUP00000001990 XP_002800554.1.72884 XP_005584174.1.63531 XP_011723540.1.29376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]