SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002165 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002165
Domain Number 1 Region: 263-320
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.81e-26
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 2 Region: 207-264
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.08e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 459-516
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.4e-24
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 4 Region: 347-404
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.93e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 5 Region: 403-460
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.37e-22
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 6 Region: 2-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.09e-22
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 7 Region: 515-566
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.57e-20
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 8 Region: 165-217
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.73e-19
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 9 Region: 310-342
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000439
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002165   Gene: ENSMMUG00000016918   Transcript: ENSMMUT00000002289
Sequence length 566
Comment pep:known_by_projection chromosome:MMUL_1:19:20510140:20545313:-1 gene:ENSMMUG00000016918 transcript:ENSMMUT00000002289 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLLTFMDVAVEFSLEEWQCLDTAQQNLYRNVMLENYRNLVFLGIAVSNLDLITCLEQGK
EPWNMKRHEMVAKPPAMCSHFAKDLRPEQYIKNSFQQVILRRYGKCGYQNLQLRKGCKSV
DEHKLHKGGHKELNQCVTTTQSKVVQYDKYVKVFHKYSKRHKIRHTGKNPFKCKECGKSF
CMLSQLTQHEIIHTGEKPYKCGECGKAFKKSSNLTNHKIIHTGEKPYKCEECGKAFNQSS
TLTRHKIIHTGEKLYKCEECGKAFNRSSNLTKHKIVHTGEKPYKCEECGKAFKQSSNLTN
HKKIHTGEKPYKCGECGKAFTLSSHLTTHKRIHTGEKPYKCEACGKAFSVFSTLTKHKII
HTEEKPYKCEECGKAFNRSSHLTNHKVIHTGEKPYKCEECGKAFTKSSTLTYHKVIHTGK
KPYKCEECGKAFSIFSILTKHKVIHTEEKPYKCEECGKTFNYSSNFTNHKKIHTGEKPYK
CEECGKSFILSSHLTTHKIIHTGEKPYKCKECGKAFNQSSTLMKHKIIHTGEKPYKCEEC
GKAFNQSPNLTKHKRIHTKEKLYKCK
Download sequence
Identical sequences A0A2K5TNY6 A0A2K6BJH0 F7GTJ8
ENSMMUP00000002165 9544.ENSMMUP00000002165 ENSMMUP00000002165 XP_001082498.1.72884 XP_005588640.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]