SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002254 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002254
Domain Number 1 Region: 24-133
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.55e-35
Family PDI-like 0.0031
Further Details:      
 
Domain Number 2 Region: 341-483
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.48e-34
Family PDI-like 0.00019
Further Details:      
 
Domain Number 3 Region: 137-240
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.64e-19
Family PDI-like 0.0084
Further Details:      
 
Domain Number 4 Region: 238-375
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000335
Family PDI-like 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002254   Gene: ENSMMUG00000001682   Transcript: ENSMMUT00000002383
Sequence length 505
Comment pep:known chromosome:MMUL_1:7:22134283:22160815:1 gene:ENSMMUG00000001682 transcript:ENSMMUT00000002383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLRRLALFPGVALLLAAARLAAASDVLELTDDNFESRVSDTGSAGLMLVEFFAPWCGHC
KRLAPEYEAAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRT
ADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASVVGFFDDLFSEAHSEFLKAASNLRD
NYRFAHTNVKSLVNEYDDNGEGIILFRPSHLTNKFEDKTVAYTEQKMTSGKIKKFIQENI
FGICPHMTEDNKDLIQGKDLLIAYYDVDYEKNAKGSNYWRNRVMMVAKKFLDAGHKLNFA
VASRKTFSHELSDFGLESTAGEIPVVAIRTAKGEKFVMQEEFSRDGKALERFLQDYFDGN
LKRYLKSEPIPESNDGPVKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELG
EKLSKDPNIVIAKMDATANDVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYL
QREATNPPVIQEEKPKKKKKAQEDL
Download sequence
Identical sequences A0A0D9RAM8 A0A2K5TWT3 A0A2K6Q133 A9X1C0 F6W4X0 Q4VIT4
ENSMMUP00000002254 ENSMMUP00000002254 ENSPANP00000014681 9544.ENSMMUP00000002254 NP_001182645.1.72884 XP_005559435.1.63531 XP_008015011.1.81039 XP_010383550.1.97406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]