SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002287 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002287
Domain Number 1 Region: 344-400
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.65e-22
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 2 Region: 231-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.26e-22
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 2-54
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.09e-21
Family KRAB domain (Kruppel-associated box) 0.00046
Further Details:      
 
Domain Number 4 Region: 387-447
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9e-21
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 5 Region: 175-232
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.43e-20
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 6 Region: 287-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.27e-19
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 7 Region: 137-189
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000123
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000002287
Domain Number - Region: 97-136
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000968
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002287   Gene: ENSMMUG00000001715   Transcript: ENSMMUT00000002419
Sequence length 461
Comment pep:known chromosome:MMUL_1:19:11425823:11452148:1 gene:ENSMMUG00000001715 transcript:ENSMMUT00000002419 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSVAFEDVAVNFTLEEWALLDPSQKNLYRDVMRETFRNLASIGKQWEDQNIEDPFKIPR
RNISHIPERLCEGKEGSQGEETFSLIPDGVLNKKTPGVKPCERSVCGEVGMGPSSLNRHI
RDHTGREPNAYQEYGKKSYTRNQCGRALSYHRSFPVRERTHPGGKPYDCKECGETFISLV
SIRRHMLTHRGGVPYKCKVCGKAFDYPSLFRIHERSHTGEKPYECKQCGKAFSCSSYIRI
HERTHTGDKPYECKQCGKAFSCSKYIRIHERTHTGEKPYECKQCGKAFRCASSVRSHERT
HTGEKLFECKECGKALTCLASVRRHMIKHTGNGPYKCKVCGKAFDFPSSFRIHERTHTGE
KPYDCKQCGKAFSCSSSFRKHERIHTGEKPYKCTKCGKAFSRSSYFRIHERTHTGEKPYE
CKQCGKAFSRSTYFRVHERIHTGEKPYENPNPNPSFVPVLS
Download sequence
Identical sequences A0A2K5UIR4 F7FZE6
9544.ENSMMUP00000002287 XP_001107785.2.72884 XP_005588124.1.63531 XP_015296052.1.63531 XP_015296053.1.63531 ENSMMUP00000002287 ENSMMUP00000002287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]